KEGG   Drosophila willistoni: 6640422Help
Entry
6640422           CDS       T01067                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dwi  Drosophila willistoni
Pathway
dwi00010  Glycolysis / Gluconeogenesis
dwi00030  Pentose phosphate pathway
dwi00051  Fructose and mannose metabolism
dwi00052  Galactose metabolism
dwi01100  Metabolic pathways
dwi01200  Carbon metabolism
dwi01230  Biosynthesis of amino acids
dwi03018  RNA degradation
Module
dwi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6640422
   00030 Pentose phosphate pathway
    6640422
   00051 Fructose and mannose metabolism
    6640422
   00052 Galactose metabolism
    6640422
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    6640422
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dwi01009]
    6640422
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dwi03019]
    6640422
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     6640422
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6640422
Messenger RNA biogenesis [BR:dwi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     6640422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 6640422
NCBI-ProteinID: XP_002063256
FlyBase: FBgn0223479
UniProt: B4MQ53
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MNSDINQRFLARGSQRDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGDCIQEASWASVSSIIHRGGTIIGSARCQDFRERAGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLEELVKNSTITPEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMLIPEEPVPVD
WQDVLCQKLVQERKAGQRLNIVIVAEGAMDREGNPITAEDVKKVIDDRLHHDARVTVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAV
AKAMKERRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDADGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGVSDGVEGLIAGNVRELGWSDVSGWVGQGGAFLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQISDQRDNYPEFCIPIVVVPSTISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIFEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPETATL
LGIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgatattaatcaacgtttcctggcccggggttcgcagcgggacaagggattg
gccgtctttaccagcggaggtgattctcaaggcatgaatgccgccgtacgagcctgcgtg
cgtatggccatctatttgggatgcaaggtttatttcattcgcgagggctaccagggcatg
gttgatggcggtgattgcattcaggaggcatcctgggcatcagtgtcctcgatcattcat
cgcggtggcacaatcattggttcggcccgttgtcaagatttccgtgaacgtgccggccgc
ttgaaggcagccaataatctgattcaacgtggtattaccaatttggtggtcatcggtggt
gatggttccctcactggtgccaatttgttccgtcaggagtggtccagtctgctggaggag
ctcgtcaagaatagtaccattactcccgagcagcaggagaagttcaatgtgttgcatatt
gttggtttggttggctccattgacaacgatttctgtggcacggacatgaccattggcacg
gatacggctctgcatcgtatcatcgaggccattgatgccatttcgagtacggcgtattca
catcaacgtacattcattatggaggttatgggtcgtcattgtggctacttagccatttca
gctgctatagctactgaagcagattttatgttaattcccgaagaaccggtgccagttgac
tggcaggatgtactatgtcagaaacttgtacaggaacgtaaagctggtcaacgtttgaat
attgtgattgtggccgagggtgccatggatcgtgagggtaatcccattactgccgaggat
gtgaagaaggtcatcgatgaccgtctgcatcatgatgcccgtgtcactgtcttgggtcat
gtgcaacgtggtggcaatcccagcgcctttgatcgtattttggcctgtcgtatgggtgcc
gaagccactttggctttgatggaggccaccaaggattcggtgccagttgttatctcattg
gatggcaatcaggcggtgcgtgtccccttgatggagtgtgttgaacgcactcaggccgtg
gccaaggccatgaaagagcgccgctgggcggatgctgttaaattgcgtggccgttcattt
gaaaggaatctggagacatacaaaatgttgacacgcttgaagccacccaaggagtgcttc
gatgccgatggcaagggcattgaaggctataggctagccgtgatgcatattggtgcccca
gcttgtggcatgaatgcagctgtcaggagttttgtacgcaatgccatttatcgtggtgat
gttgtctatggtgttagcgatggtgtcgaaggtttgattgctggaaatgttagagaattg
ggatggtccgatgtgtccggttgggttggccagggtggcgcctttttgggcaccaaacgt
accctgcccgagggcaaattcaaggaaattgccgcacgccttaaggagttcaaaatccag
ggtcttctcattattggcggctttgagagttatcatgccgctggacagatatccgatcag
cgtgataattatcccgaattctgtattcccattgttgtggttccctcaaccatttcgaat
aatgtgcctggcactgaattctccttgggttgcgataccggcttgaacgagatcaccgag
atttgtgatcgtattcgtcaatcggcccagggtaccaagcgtcgtgtctttgtcattgag
acaatgggtggctattgcggctatttggccactttggctggcctggctggtggcgctgat
gctgcttacatttttgaagagaaattctccattaaggatctgcaacaggatgtctatcac
atggcctccaagatggctgagggtgtctcgcgtggtttgatcctgcgcaatgagaaggcc
agcgagaattatacaacagatttcatctatcgtctgtattcggaagagggcaaaggtctc
ttcacctgccgcatgaacattttgggccatatgcaacagggcggctcacccactcccttc
gatcgtaatatgggcactaagatggccgccaaatgcgtggactggttggccactcaaatc
aaggccaatatcgatgccaatggtgtggtcaattgcaagtcacccgaaacagccaccttg
ctgggcattgtatcccgccaatatcgttttagcccactggtggatctcattgccgagaca
aactttgatcaacgcatccccaaaaagcaatggtggttgcgtctccgccctcttcttaga
attctggccaagcacgattcggcctatgaggaggaaggcatgtacatcaccgtggaggag
gaatgcgccactgatgctgtagcctaa

DBGET integrated database retrieval system