KEGG   Drosophila willistoni: 6640514
Entry
6640514           CDS       T01067                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dwi  Drosophila willistoni
Pathway
dwi00061  Fatty acid biosynthesis
dwi00071  Fatty acid degradation
dwi01100  Metabolic pathways
dwi01212  Fatty acid metabolism
dwi04146  Peroxisome
Module
dwi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    6640514
   00071 Fatty acid degradation
    6640514
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    6640514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dwi01004]
    6640514
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    6640514
Enzymes [BR:dwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     6640514
Lipid biosynthesis proteins [BR:dwi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   6640514
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   6640514
  Exosomal proteins of breast cancer cells
   6640514
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 6640514
NCBI-ProteinID: XP_002063081
FlyBase: FBgn0223718
UniProt: B4MPM8
LinkDB
Position
Unknown
AA seq 715 aa
MFIEDDAQMDSFWVQSAIGAIKAIAFVYDIITLPVYLVLQAPWKRRQDSRRVKAKVIKND
DNELTYRTTEPPRDVHVKMLQENIDTLEKVFNYVAKTHSSKRCLGTRQILSEEDEVQPNG
RVFKKYNMGDYKWKNFTEAERMAASFGRGLRELGQKPRENIVIFAETRAEWMIAAHGCFK
QAMPIVTVYATLGDDGVAHCISETEVTTVITSHDLLPKFRTLLAQCPNVTTIIYMEDQLH
KTETTGFKEGVKVLPFAQVVKTGQDSKFENVPPKGDDIAIIMYTSGSTGTPKGVLLSHKN
CIATMKGFCDMVPIYPDDVLIGFLPLAHVFELVAESVCLMTGVSIGYSTPLTLIDTSSKI
KRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSDSAFKKALFKFLYQYKVKWITRGY
LTPLIDKLVFKKVAKLMGGRVRIMMSGGAPLSSDTHEQIKTCLCVDLIQGYGLTETTSGA
TVMDYRDMTYGRTGAPLTVCDIRLVNWEEGNYRITNKPYPQGEVLIGGDCVSQGYYKLPG
KTNEDFFEEDGRRWFKTGDIGEVQSDGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCG
IIENICVYGDPTKQFTVALVVPNQKHLEELAERHGLQNKSFEDLCSSPVMEKAILKEIAD
HSRKCKLQKFEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMYAS
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgttcatcgaagatgatgcgcaaatggacagtttctgggtgcagagcgcaattggtgcc
atcaaggcaattgcattcgtttatgatatcataacgctgccggtctatttggtattgcag
gcgccatggaaacgtcgacaggactcgaggcgtgtgaaggccaaagtcatcaagaatgat
gataatgagctaacatacaggaccacggaaccaccacgtgatgtccatgtgaagatgcta
caagagaatatcgatacattggagaaggtcttcaattatgtggcaaaaactcattcatcc
aaacgttgcctgggcaccaggcaaatccttagcgaggaggatgaagtgcagccaaatggt
cgtgtctttaagaaatacaatatgggcgattacaaatggaagaatttcaccgaagcggaa
cgcatggcagctagttttggacgtggtctacgtgaattgggacagaaacctcgtgagaat
attgtgatctttgccgaaacgcgagcggaatggatgattgcggcccatggttgtttcaaa
caggccatgcccattgttaccgtctatgccactttgggagatgatggtgtggctcattgt
atctcggaaacggaagtaaccacagtgataacctctcatgatctattgcccaagttcagg
actttgctggctcagtgcccaaatgtgactaccattatctatatggaggatcagctgcat
aagacagagaccacaggcttcaaggagggtgtcaaggttttgccatttgctcaggttgtc
aaaacgggtcaggactctaaatttgagaatgtgccaccaaagggcgatgatattgccatt
attatgtacacttctggttcgactggcacaccaaaaggtgtacttttgtcgcataaaaat
tgcattgccaccatgaagggtttctgtgatatggtgccaatttatccagatgatgttcta
attggttttctgccattggctcatgttttcgaattggttgccgagagtgtttgcctaatg
acgggcgtatccattggttattcaacgccattgacactgatcgatacgagtagcaagata
aagcgcggatgcaagggagatgccaccgtattgaaaccaacttgcatgacttcggtgcca
ttgatacttgatcgcatttccaagggcattaacgacaaggtcaactctgattcggcattc
aagaaggcattatttaaatttctttatcagtacaaagtgaaatggataacacgaggctat
ctaacgcccttgattgacaaattggtctttaagaaagtggctaaattaatgggtggacgt
gtccggattatgatgtctggtggagctcctctatcatcggatacacatgaacagattaag
acatgtttgtgtgtggatttgattcagggttatggtctaacagagactacatcgggagct
acagtaatggattatcgtgacatgacctatggacgcactggtgcccccttaactgtctgc
gatatacgtttggtcaactgggaggagggaaattatcgcattacaaacaaaccctatccc
caaggagaagttttaattggtggcgattgtgtatcacagggttattataaattgcctggc
aagaccaatgaagatttcttcgaggaagatggtcgtcggtggttcaaaactggtgacatt
ggtgaagtgcaaagtgatggtgtacttaaaattattgatcgcaagaaggatctcgttaag
ctgcaggccggcgaatatgtgtcattgggcaaagttgaatcggaattgaagacatgcggc
attattgagaatatttgcgtttatggtgatccaactaagcaatttactgtagcgctggtc
gtaccaaatcagaagcatcttgaagaattggccgaacgtcatggacttcagaataaatca
tttgaagatctgtgctcatcacccgtcatggagaaggccatactcaaggaaattgccgat
cattcacgcaaatgcaaattgcaaaagttcgaagtgccggcagccataacgctttgcaag
gaagtctggtcaccggatatgggtttggtgacggctgcctttaagctcaagcgcaaggat
attcaggatagatatcagcatgatattaatcgcatgtacgcctcatga

KEGG   Drosophila willistoni: 6645936
Entry
6645936           CDS       T01067                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 5 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dwi  Drosophila willistoni
Pathway
dwi00061  Fatty acid biosynthesis
dwi00071  Fatty acid degradation
dwi01100  Metabolic pathways
dwi01212  Fatty acid metabolism
dwi04146  Peroxisome
Module
dwi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    6645936
   00071 Fatty acid degradation
    6645936
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    6645936
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dwi01004]
    6645936
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    6645936
Enzymes [BR:dwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     6645936
Lipid biosynthesis proteins [BR:dwi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   6645936
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   6645936
  Exosomal proteins of breast cancer cells
   6645936
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 6645936
NCBI-ProteinID: XP_002068404
FlyBase: FBgn0222437
UniProt: B4N4V1
LinkDB
Position
Unknown
AA seq 704 aa
MTPEKSVLAYVNHLIVSNFSYFWDEIDGYLNYFGGTLGTLTLTSVAASIAYYFATRPQPE
KPLVPLENQSPLLEGPEQIHVSKFYKESKNGKFVSYITENVRTLYQTFREGAYASNNGPC
LGWRETLTSPYQWINYDEALLRAKNFGSGMLALGARPKQLIGIYSQNRPEWILYEQGCYS
FSLVVVPLYDTLGPDACAFIIRQTEMSIVIVEDDGKASMLLEKAPRSLKIIVSIKPIRQT
TLERARSRGIQIFSFIDVEKLGAKGNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNV
VAGVCAVILQMGDHRIRAGDVMVSFLPLAHMFERCCENGMYYVGGCVGFYSGDIKELTND
LKMLKPTVMPAVPRLLNRVYDKIQNDIAASGLKRGLFNMAMKAKEKEIARGIMRRNGCWD
KLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQG
DHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSE
GWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESL
KSCIIAVVVPDVDVLKLWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQV
KDVYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYKHLD
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgacgccagagaaatcggttttagcctatgtcaatcatttgatagtcagcaatttttca
tatttctgggatgaaattgatggctatcttaattatttcggtggcactttgggcaccttg
accttgaccagtgtggcggcaagtattgcctattattttgcaacgcgaccacaacctgaa
aaaccgttagtgcctctggaaaatcaatcaccattattggagggtccagaacaaatacac
gtttcaaaattctacaaggaatcgaaaaatggtaaatttgtctcctacatcacagagaat
gtacgcaccctatatcagacatttcgcgaaggagcctatgcctcaaataatggaccatgt
ttgggatggcgtgagaccctaacatcgccctaccagtggatcaactacgatgaggccttg
cttagagccaaaaactttggctctggcatgttggcattgggtgctcgacccaaacagcta
attggcatctattcgcaaaatcgacccgaatggatattatatgagcagggttgctattca
ttttcattggttgtggtgccattatacgatactttgggtccagatgcctgtgcttttatc
atacgacaaacggaaatgtccattgtgatagtggaggatgatggcaaagcatccatgctg
ctggagaaggcaccgcgtagcctaaagataattgtatcgatcaaacccatacgtcagacg
acactggaacgggcccgtagccggggcatacagatcttctcgttcatcgatgtggagaaa
cttggcgccaagggcaatcatccggaggtgccacccacagcggaagatttgtgcacagtg
tgctacacatcgggcacaacgggcaatccaaagggcgtaatgctcacccacggcaatgtg
gtggccggtgtctgtgccgtcatcctgcagatgggtgatcatcgcattagggccggtgat
gtcatggtttccttcttgccattggcccacatgttcgagcgatgctgtgagaatggcatg
tactatgtaggcggctgtgtgggcttctattctggtgatattaaggagctgaccaatgat
ctgaaaatgctgaaaccgacggtaatgcccgctgtgccgcgtctcctcaatcgtgtctat
gataagatacaaaacgatattgccgcatcgggcctgaaacgtggtctcttcaatatggcc
atgaaggccaaggagaaggagatcgcccgcggtattatgcgacgcaatggctgttgggat
aagcttgtcttcaagaaggtccatcaggcatttggtggcaatttacgtctaatggttgtc
ggctcggcaccattggctggcaatgtcctgacctttatgcgctgtgccttgggctgtttg
gtcctggagggctatggccaaacggaatgcactggtgccatcaccctaacagttcagggt
gatcatgtgcccaatcatgtgggtcctccggtatcttgtaatgctgtcaaattagtcgat
gtacccgaaatggaatatttcgccaatcaaaatacaggagaagtctgtgtccgaggctca
aatgtgttccatggttactacaaagatcctgagaagacagccgaggctattgattccgag
ggttggcatcatacaggcgatgtgggaatgtggctaccaaatggcactctacgtattatt
gatcgtcgcaagcatatctttaagctcagtcagggtgaatacattgtacccgagaaaatt
gagaatatctacacattgagtcaatatgtgaatcaagtctatgtttatggtgaaagctta
aagagctgcattattgctgttgttgtacctgatgtcgatgtactaaaattatgggccaca
gagaacaatgtacgcggcacactgtccgtcctatgcaataataagaatgtcaaggaacta
attatgaatgatatgctcaattggggcaaacaaagtggactgaagtcattcgaacaggtc
aaggatgtctatctgcatccagatcctttctcggtacaaaatggattgctaacgcccaca
ttcaaggccaagagaccgcaattgaagagctatttcaagccacaattggaggatatgtat
aaacatttggattga

DBGET integrated database retrieval system