KEGG   Drosophila willistoni: 6642290
Entry
6642290           CDS       T01067                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase bubblegum-like
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
dwi  Drosophila willistoni
Pathway
dwi00061  Fatty acid biosynthesis
dwi00071  Fatty acid degradation
dwi01100  Metabolic pathways
dwi01212  Fatty acid metabolism
Module
dwi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    6642290
   00071 Fatty acid degradation
    6642290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dwi01004]
    6642290
Enzymes [BR:dwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     6642290
Lipid biosynthesis proteins [BR:dwi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   6642290
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 6642290
NCBI-ProteinID: XP_002064764
FlyBase: FBgn0217033
UniProt: B4MVN0
LinkDB
Position
Unknown
AA seq 691 aa
MNDVDLRQSIDSGKLKPATSYTSTSLHEGVKLRLGETGPLSELPPTTLPQMFREACEKYA
EHPALTWETPGAGDQGWTTLSYKDYQKQVEQVALLLIDAGLEERSSLGVLAFNCPEWFFA
EFGALRAGGVVAGIYPSNSAEAVRHVLDTSEATVCMVDDAQQMAKLRAIKESLPRLKTVI
QLHGPFESFVNQESGYYSWQKLMEKVYPISLKEELLCRENRICANECAMLIFTSGTVGLP
KAVMLSHDSIVFDTKAIDLSMRNIELGNERMVSYLPLSHIAAQIFDIFLAMQHGGCVTFA
DKDALKGTLVKTFLKAKPTRMFGVPRVFEKFQERLVAAEAKAKPYSRLILAKARQVVAQH
QMTSILGEKHSIYSSSKYWLASRVVRPIRQMLGLDSCKTFLTGGAPVSDEMKNFFLGLDM
PLGECYGMSETGGAITLNVEITNLFSSGQPICGLEVEIKEPDANGHGEICMRGRSNFMGY
LGQPDKTMEAIKEDGWLHSGDLGYLDEHGNVVISGRLKELIITAGGENIPPVHIEELIKK
ELPCVSNVILIGDHRKYLTVLISLKTKSDSKTGIPLDALREETIEWLNELDLHQTRLSEL
LGISGDLQLPNDAAALTAALAIKAEPKLLEAIEAGIKRANKNAISNAQKVQKFALIPHEF
SLATGELGPTLKIRRNIVHAKYAQVIERLYK
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgaacgacgtggatctaagacagagcatcgacagtggcaaactgaagcctgccacgagt
tatacgagtacctcactccatgagggagtaaaactccgtttgggtgagaccggacccttg
tccgagttgccaccaacgacattgccgcagatgtttcgcgaggcttgtgaaaaatatgca
gaacatcctgctctcacctgggagacaccaggagctggcgatcaaggctggaccacgttg
agttacaaggattatcagaaacaagtagaacaggtcgcccttttgctgatcgatgctggt
ttggaggagcgcagctctttgggtgttttggccttcaattgtcccgaatggttctttgcc
gaatttggagccttaagagctggtggtgtggtagctggcatttatcccagcaactcggca
gaggctgtgcgtcatgtcttggatactagtgaggcaaccgtttgtatggtcgatgatgct
cagcaaatggccaaattgagagccatcaaggagagtttgccacgtctgaagactgtcata
caattacatggtccattcgagtcgtttgtgaatcaggagagtggctactacagctggcag
aaactgatggagaaggtctacccaattagcttaaaggaagaacttttgtgtcgtgagaat
cgtatttgtgcaaatgaatgtgcgatgcttatatttacctctggcactgtgggattaccc
aaggcagtgatgctctcacatgatagcattgtctttgacaccaaagccattgatctgtct
atgcggaatatagaattgggaaatgagcgaatggttagctatctaccattgagtcatata
gcagctcaaatctttgacatatttctggccatgcaacatggtggatgtgttacatttgcg
gataaagatgccttgaagggaactctagtgaaaacattcctaaaggccaagccaactaga
atgtttggagttccacgtgtctttgagaagtttcaagagcgtcttgttgctgccgaggcc
aaggccaagccatattctcgtttgattttagccaaggctcggcaggtagtggcccaacat
caaatgaccagcatattgggtgagaaacattctatatattcgtcttcgaaatattggcta
gcctcccgtgtcgttcgtcccatacgccaaatgttgggtcttgatagttgtaaaactttc
ctcactggcggcgctcctgtatcggatgaaatgaagaacttcttcctgggcttggatatg
cctttgggtgaatgctatggcatgtcggagactggtggagccatcactttgaatgtggaa
atcacaaacctcttcagttctggccaacccatttgtggtctggaggttgagattaaagaa
ccagatgctaatggtcacggtgaaatatgtatgcgtggtcgcagtaactttatgggttat
ctgggacagcccgataagactatggaggccatcaaagaagatggttggctgcacagcggt
gatctcggctatctggatgagcatggtaatgtagtaatttcgggacgcctcaaagaattg
atcataacggcgggaggggaaaatattccacccgttcacattgaagaactgatcaagaag
gaattaccctgtgtcagtaatgtcattctaatcggagaccatcgcaaatatctcacagtg
ttgatatcactgaaaaccaaatcggactcaaagactggaataccattggatgcattgcgt
gaggagacaattgaatggttgaatgaattggatctacatcagacgcgtctttcggaactt
ttaggcatatcgggtgatctgcaattgcccaatgatgcagctgctctaactgccgctttg
gctataaaggcggagccaaaacttctcgaagccatcgaagcgggcatcaagcgtgccaat
aagaatgccatttccaatgcgcagaaagttcagaaatttgctttaataccacatgaattc
tcattggccactggtgaattgggacccactttgaaaatacgtcgaaatattgttcatgcc
aaatatgctcaagttattgaacggctctataagtaa

KEGG   Drosophila willistoni: 6642787
Entry
6642787           CDS       T01067                                 

Definition
(RefSeq) very long-chain-fatty-acid--CoA ligase bubblegum
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
dwi  Drosophila willistoni
Pathway
dwi00061  Fatty acid biosynthesis
dwi00071  Fatty acid degradation
dwi01100  Metabolic pathways
dwi01212  Fatty acid metabolism
Module
dwi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    6642787
   00071 Fatty acid degradation
    6642787
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dwi01004]
    6642787
Enzymes [BR:dwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     6642787
Lipid biosynthesis proteins [BR:dwi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   6642787
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 6642787
NCBI-ProteinID: XP_002064766
FlyBase: FBgn0217032
UniProt: B4MVN2
LinkDB
Position
Unknown
AA seq 666 aa
MSTNEALFNRPGPNRLRPAEVYRTTVPTEAVKIRMHKDGLGAEEPISIPGLLKRTVNNYP
EYPALRSKNGKNGYTTVTYRQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMG
AIHARGIIAGIYTTNSADAVLHVLDNSKAQIVVVDDSKQMDKIHAIRDKLPNLKAAIQIQ
EPYAPYLKKEDGYYRWSEIESMNVSDVEDKFKQRLENIAINECCCLVYTSGTVGMPKGVM
LSHDNITFDARGIVKSLEKIVVGAESIVSYLPLSHVAAQTVDIYTAAAIACCIWFADKDA
LKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSFKKMLAGWAKGITLKHYMES
QGKTSGGFRYKIAKSLIMSKVKQALGFDHVVTLVSAAAPMSPETKKYFLSLDLKILDAFG
MSETGGCHTICLPDSVALNSIGKTMPGCESKIINKDESGHGELCIRGRHVFMGYIDNKEK
TEESLDDDCWLHSGDLGYIDDKGYVCLTGRSKEIIITAGGENIPPVHIENMIKKELDGIS
NAFLVGEQRKYLTVLLTIKTELDKDTGEPLDELTHESSVWMKSLGVEYKTLSEILKAGPC
PKVWKSIEDGIKRANKHSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVAKQYADE
IEKLYA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgtccacaaacgaggcgctctttaatcgtcctggccccaatcgcctgaggccagcggag
gtctatcgcaccaccgtacccacagaggccgttaagatacggatgcataaggatggactc
ggtgccgaggaacccatctctatacccggcctcctgaagcgcactgtcaacaattatccc
gagtatccggcgttgcgttcaaagaacggcaaaaatggctacacgaccgttacctacaga
caatatgagcaaaaagtccatcaggtggccaaagccttcattaaactgggcctagaggag
catcattcggttggtgtgttggccttcaattgcgcggaatggttctactccgccatgggt
gccatacatgcacgcggtattatagctggcatctataccacaaattcggcagatgctgtc
ctccatgtgctggataactccaaggctcagatcgttgtggtcgatgattccaagcagatg
gataaaattcacgccatacgcgataagttgcccaatctaaaggctgccattcaaattcaa
gaaccctatgctccatacctgaagaaggaggatggctactataggtggtcggaaatcgag
tcgatgaacgttagcgatgtggaggacaagttcaagcagcgtctggagaatattgccatc
aatgaatgctgttgtctggtctatacatccggcactgtcggtatgcccaagggtgtaatg
ctgtcacatgataacatcaccttcgatgcacgcggcattgtcaaatctctggagaagatt
gtggtgggagctgaatctatagtatcgtatttaccactttcccatgtggctgcccaaacg
gttgacatttacacagcggctgccattgcctgctgtatttggtttgccgataaggatgcc
ctaaagggaaccctggtcaaatcattgcaagatgcccgtcccacacgattcatgggtgtt
cctagggtctacgaaaagttccaggaacgtatggttgccgttgccagttctagtggtagc
ttcaaaaaaatgcttgccggctgggccaagggcatcacattgaagcactacatggagagt
caaggcaaaacctctggtggtttccgttacaagattgccaagtcgctcatcatgtccaag
gtgaaacaggccttgggtttcgatcatgtggttactttggtcagcgccgctgctcccatg
tcaccggagactaagaaatatttccttagtttggatttgaaaattcttgatgccttcggc
atgtcagagactggaggatgtcataccatttgtctgcctgactcggtggccctcaattcc
attggcaaaacgatgcccggctgtgagtcgaagatcatcaacaaggatgagagtggacat
ggtgaattgtgtatacgtggacgtcatgtgtttatgggctacattgacaacaaggagaag
accgaagagtcactggacgatgattgctggttgcattccggtgatttgggctatatcgat
gataagggctatgtttgcctcacaggacgttccaaggagattattattacagccggcgga
gagaatattccaccagttcatattgagaatatgattaaaaaggaattggatggcatttcc
aatgccttcctggtgggtgagcaacgcaaatatcttactgtgctgttaacaattaagacc
gaactggataaggatactggcgagccactggatgagcttacccacgagtcttcggtatgg
atgaaatcattgggagttgaatacaagactctgtcggaaatccttaaggcaggaccatgc
cctaaggtatggaaatccattgaggatggcattaaacgggccaacaaacactccatctcg
aatgcccaaaaggtgcaaaagtttaccattttgccacatgatttctccattcccaccggt
gaattgggacccactctgaaggtcaagcgtaatgtggtagctaaacaatatgccgatgag
attgagaaactctatgcttaa

DBGET integrated database retrieval system