KEGG   Drosophila willistoni: 6644450
Entry
6644450           CDS       T01067                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dwi  Drosophila willistoni
Pathway
dwi00230  Purine metabolism
dwi01100  Metabolic pathways
dwi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6644450
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6644450
Enzymes [BR:dwi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     6644450
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 6644450
NCBI-ProteinID: XP_002067206
FlyBase: FBgn0226103
UniProt: B4N130
LinkDB
Position
Unknown
AA seq 1182 aa
MPEEKEKSSNNLENGQATSTAPATASPTATGKLKHQRQKTPTRRRPHDDEVVAGGVGITG
GGVVILPQHVLNELYHNYSIKQRRSGLKWFLFAAILFNLWTICIPWEQAVPTRVVNCCML
VAYLALTALLHIGRRSEQPSMRSLHQAMLTIIPKALWFLAMLHFAAYVMLQASFSPRDVL
GWAILLNFLIYVTLPLPLIFLGLVVGFCTYFNCLSVPVAFSRPDPLISDQAAANAVLIAT
GAVIGLLYYFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDL
GSSTSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQ
QLRIKILGDCYYCISGAPDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGA
VLAGILGQRQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKRE
ELLRIAGLKTFFITKVVKPFASPCAKKINETQRENSHNGSNGSTGGGLATTDDNEATLDD
EELLAESATTNGQHLTPEAEDEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKN
PQLEQAYAIYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVVI
SIAESFSGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFLRTEHIV
SESEFNATASEVIMVEDGGQILEEEMATAEHLLPESFVEQMRDAVPTERDLYPSYLSNFG
VLILIAIAVIAQLTHLTKILLLLSIAALHCYFNIFIMQDLYALEDDLAHQPIISTRYCAS
GLLLVAALALSTLARHMDHEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEH
FMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDAL
LELPQFQDIIKIKTIGSTYMAASGINLQRNLRTDAPITERWSHLAVLVEFALELKHALQN
INEQSFNHLVLKMGINHGPITAGVIGARKPHYDIWGNTVNVSSRMESTGKAGAIQVTEET
CNILQQFGYTFLQRGLVAVKGKGQLMTYYLQGKSQSNPDPAASVELHAETTETPLELTTE
LEVDIKTPLLKLKNPDSAPTDASAPESSVGNGNVAESQSLLE
NT seq 3549 nt   +upstreamnt  +downstreamnt
atgccggaagagaaggagaaatctagtaataatcttgaaaatggtcaggccacgtccaca
gctccggctaccgcttcgccgacagcaaccggcaaattgaagcatcaacgccaaaagacg
cccacacgacggcgtcctcatgatgatgaggtcgttgctggaggtgttggcatcaccggc
ggcggtgtggttatcctaccgcagcatgtactcaacgaattgtatcacaactattccatt
aaacagcgacgtagcggtctcaagtggttcctttttgcggccattctatttaatttgtgg
accatttgtataccatgggaacaggcagtgccaacaagagtggtcaactgttgcatgctg
gtagcatatttggctttaaccgctctcctgcatattggacgtcgttcggaacagccatcg
atgcgtagtttacaccaggcaatgttaacaataataccgaaagctctctggttcctggca
atgttgcattttgccgcttacgtaatgctgcaagccagtttctcaccgcgtgatgttctc
ggttgggccatattgcttaactttttaatctatgtaacattacccttgccattgattttc
cttggcctagtggttggcttttgtacgtacttcaattgtttaagtgttcctgtggctttc
tctcgacccgatccacttatatctgatcaggcagccgctaatgctgttttgatagccact
ggagctgtaattggtttgctttattattttatgggcgaagccaagcagaaaagggcattt
ttagaggccaagaaaagtctagaggttaagatggtaatcgaggagcaatcggctgaacag
gaacgcctgctgttatccgtactaccaaaacatgtggctatcaagatgcgtgaagatttg
ggctcttccacttcagaggcattcaaaaagatttacatgagtcgacacgaaaacgttagc
atactttatgcggatattgttggctttactgccatctcctcaacatatagcgcccaagat
ctggttaaaatgcttaacgagctcttcgcacgcttcgataggcttgccgagaaataccaa
caactacgtattaaaattcttggtgattgctattattgcattagcggtgccccggatgag
cgtccggatcatgccgtgatgtgtgtacacatgggactttctatggttaaggccatcaag
tatgtgcaacaaaaggcaaactcacctgttgatatgcgtgtgggcatccacaccggggct
gtcttggctggcattcttggccaacgtcagtggcaatttgacgtttactccaaggacgtt
gagctggccaataaaatggaatcgagcggcaaggctggacgcgttcacatttcggacaaa
accttggcctttctcaatggtgaattcgaagtggaaccagcatttggtgagaaacgtgag
gaactgttacgaattgccggattaaagacattttttataaccaaagtggttaagccgttc
gcttcgccgtgtgccaagaaaatcaatgaaactcagagagaaaattcgcataatggttcg
aatggttcaactggcggtggattagctacaactgatgataatgaggctaccttagatgat
gaggaactattggcagagagcgccacaaccaatggacaacatcttacacccgaagcggaa
gatgaagaggaacaggttaaattggagaatttcaagcaacgattgaaagacgaactagtc
actagagatggacatgaaaatctaaccaaggacacaaatatatttttacgttttaagaat
cctcaattggaacaggcctatgccatttatcgggagccatatagttctctgccattattg
gctgctttgttggttcaatgcattgatgttctatattcgtatttggttttgcctcgatcc
acattgcattttattaatatagccgctcctttggtacccattgccatgctggtggtgatt
agcatagcggagagctttagcgggatgttgccaaagttctttgtcgatgttagtaaacga
ttcaatgacattaccttcgtgcgtgaactggctgccataattatagcccttaccattggc
cttagcaatgtcatcgacatgttcttttttgtcaccttcctgcgcacagagcatattgtt
agcgaaagtgaattcaatgccacggccagtgaggttataatggtcgaggatggtggtcag
atattggaagaggagatggcaactgctgaacacctgctaccggaatcatttgtcgaacaa
atgcgcgatgcagtgcccacagagcgtgacctttatccgtcctatttgagtaattttggt
gtcttaatattaattgcaattgccgtgattgcccagctcacgcacctaacaaaaatacta
ttgctattgtctatagcagctctgcattgctatttcaacatatttattatgcaggatttg
tatgcccttgaagatgatctggcacatcaacccatcatatccactcgttattgcgcctcg
ggtctacttttggtggccgccttggctcttagcactttggcacgacatatggatcacgag
gatcgtgtgattttcaagtggaaaacagaagtggccgaacagaaggaaaccgccaacgat
atgcgtcaacgtaacgaggctttggtctataatgtattgccagttcatgtggctgaacac
tttatgaagaacacaaaacgatcccatgacgatttatattcccaaagttatgcagaagtt
ggcgtcttatttgccagtatgccaaatttttcagatttttattcagaggaaaccgtcaac
aatcagggtttagagtgtttacgttttcttaatgaagtcatctcggattttgatgcgtta
ctcgagttgccacaatttcaggatataataaaaatcaagaccattggctctacatatatg
gccgccagtggcattaatttgcaacgaaatctacgtacggatgccccaattactgaacgt
tggtcccatttggctgtattggtggaattcgctttggaactgaaacatgcattgcagaat
atcaatgagcaatcgtttaatcatttagtacttaaaatgggcatcaatcacggccccata
acggccggagtaattggtgccaggaagccgcactatgacatttggggcaacacggtgaat
gtttcatctcgcatggagagcactggcaaggcaggtgccatacaggtgaccgaagagact
tgcaatatcctacagcaatttggttatacgtttctgcaacgcggccttgtggccgttaag
ggcaagggtcagctaatgacatactatttgcagggcaaatcacaatcgaatccagatcct
gctgcctctgtggagttgcatgccgagacaacagaaacgccactggagttaaccacagag
cttgaggtcgatataaagacgccgctgttgaaactaaagaatcccgattctgcaccaacg
gatgcttctgccccagaatcatcggtgggcaatggcaatgttgccgaatctcaatcattg
ttagagtaa

DBGET integrated database retrieval system