KEGG   Drosophila willistoni: 6645270
Entry
6645270           CDS       T01067                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
dwi  Drosophila willistoni
Pathway
dwi04013  MAPK signaling pathway - fly
dwi04214  Apoptosis - fly
dwi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6645270
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6645270
   04215 Apoptosis - multiple species
    6645270
SSDB
Other DBs
NCBI-GeneID: 6645270
NCBI-ProteinID: XP_002067955
FlyBase: FBgn0213638
UniProt: B4N467
LinkDB
Position
Unknown
AA seq 445 aa
MAVPFYLPEGGTDDIASSSSGASGSSNASTSSGASTTSSSGSSDGGSSSVQSQSPNTTTS
ATQTPMQSPLSVPTDQVLVALCEWYRLYNAHTNAPTQIFQYPPPPSPSCSCTGGDVFFPH
HGGPPQPPRTPRTSVSFASGEELSFFRQPYPAAPSTPQPMPQQPPAPQSAPPLHYSHSYP
QQSPHLLQHHPASYGGGMQPLQLPQGAYYATYTPPPTPNTANMGNNCNNNTSSLASSSAM
TAAFGWHGHGPSLAASTPLAPNGSKMRLQRSQSDAARRKRLTSTGEDEREYQSDHETSWD
EFDDRYDNFTAGRERLQEFNGRIPPRKKKNSHSHTNHRPSSPNNSNTHSHSNSNNNSNCN
THAHNQFNSSSAESNSSSSSSSITNNITNKNNCNIASSQHQQQQHRQQSHSQVQAKQKKP
PQSFTWPTVVTVFVLAMGCGFFAAR
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatctgcctgagggtggcaccgatgacattgcctcgagttcatcg
ggcgcctccggttcatcgaatgcctcaacatcgtcgggtgcatccacaacatcgtcatcg
ggctcatcggatggtggttcaagcagtgtgcaatcccaatcgccaaataccacaacatcg
gccacacagacgcccatgcagtcgccattgtccgtgcccacggatcaggtgcttgtggcc
ctatgcgaatggtatcgcctctacaatgcccatacaaatgcaccaacacaaatctttcaa
tatccgccaccgccaagcccttcatgcagttgcacaggaggcgatgtattctttccccat
catggtggtccaccccaaccaccacgaacgccacgcactagcgtcagttttgcctctggc
gaggagctgagtttcttccgtcaaccgtatccggcagcgccatcgacaccacagccaatg
ccacaacaaccaccggcgccacagtcagcgccaccgttgcactatagccacagttatccg
caacaatcgccgcatttgctgcaacatcatccggcctcatatggcggtggtatgcagccg
ttacaattgccacagggtgcctactatgccacctatacgccgccacccacaccgaataca
gccaatatgggcaacaattgcaacaacaacacatcatcgttggcatcatcatcggctatg
acagcggcctttggctggcatggtcatggtccatcattggctgcatcaacaccattggcg
ccaaatggctcaaagatgcgtctacaacgcagtcaatcggatgcggctagacgcaaacgt
ttgacctcaactggcgaggatgaacgcgaatatcagagcgatcatgagaccagctgggat
gaatttgatgatcgttatgataattttacggccggacgtgaacgtttgcaggagttcaat
ggccgtataccgccacgaaaaaagaaaaatagtcacagtcacacaaatcataggccaagc
agtccaaataactcaaatacgcatagccacagcaacagcaacaacaacagcaactgcaac
acccatgctcataaccaattcaattcatctagtgcggagagcaacagcagcagcagcagc
agcagcatcaccaataacattaccaacaagaacaactgcaacattgcctccagtcagcat
cagcagcaacaacatagacagcaaagccatagccaagtgcaggccaaacagaagaaacca
ccacagagtttcacttggccaacagttgtgaccgttttcgtacttgccatgggctgcggt
ttctttgccgcacgatga

DBGET integrated database retrieval system