KEGG   Drosophila willistoni: 6645578
Entry
6645578           CDS       T01067                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dwi  Drosophila willistoni
Pathway
dwi04214  Apoptosis - fly
dwi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6645578
   04215 Apoptosis - multiple species
    6645578
SSDB
Motif
Pfam: Presenilin TMEM132D_C
Other DBs
NCBI-GeneID: 6645578
NCBI-ProteinID: XP_002067945
FlyBase: FBgn0213582
UniProt: B4N457
LinkDB
Position
Unknown
AA seq 150 aa
MAIAYFIPDQAQLLARSNQQSNGQQANNNSTESNRRSPSATSRQQQQEQQQQHRSQFRAN
ITVPLGSQQGAMSMSEFGCWELLAQIFCYALRLYSHQPRRSTVIQISFEICPGSEETATP
TTTTDPVAVPRDNDDEGDVTDDANLSGKQD
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccatagcttattttataccagatcaggcacaattgctggcccgaagtaatcagcaa
agtaatggtcaacaggccaacaacaattctacagagtcaaatagaagaagtccatcggca
acctcacggcagcaacaacaggaacagcaacaacaacatcgttcacaatttcgcgccaac
atcactgtgcctctgggcagtcagcaaggagccatgtccatgtctgaatttggctgctgg
gagctattggcccaaattttttgctatgctttgcgactctatagccatcagccccgtcgg
tcgacagtcatacagatttcctttgagatatgtcctggctcagaagaaacagcaacacca
acaacaacaaccgatccagttgcagttccacgagataatgacgacgaaggtgatgtgact
gatgatgccaatttgagtggaaagcaagattaa

DBGET integrated database retrieval system