KEGG   Drosophila willistoni: 6645650Help
Entry
6645650           CDS       T01067                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dwi  Drosophila willistoni
Pathway
dwi00020  Citrate cycle (TCA cycle)
dwi00190  Oxidative phosphorylation
dwi01100  Metabolic pathways
dwi01200  Carbon metabolism
Module
dwi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dwi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dwi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6645650
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6645650
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6645650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 6645650
NCBI-ProteinID: XP_023033247
LinkDB All DBs
Position
Unknown
AA seq 509 aa AA seqDB search
MTLYVPKGRVVCELDHRNGMSFSRTENGKIYQRPFGGQTLDYGKGGVARRVCCVADRTGH
SVIHTLYGQTLFHIYEDQCHYYVDYFVLDLIMCECTSVGCLAWKLNVGTFHRFMGKNTVI
ATRRCALEMALPRQQLRLQDMEFVQFHPTGIYGAGGVCSEGGFFVNEKGERFMERYAPEA
KDLAYLDVVARAMAMEVLNGNGCGPLKDHVHLHLHHIDARIIRERLPGIMATARIFAKVD
VTKEPVPVLLTVHYTMGGIPTTYMGRVLTRSSQDEGQDEIVAGLYACGEAACASVHGANR
LGANLLLDLIVFGRLRALDIAANNCPGEEIPAIDENATKXSMNNFIFADGKIPTAVIRLE
QQRTLTKHAAVFREGKLLKEGLDKVAELCQQLKDVKVFDRTLIWNTDLVETLELQNMLAN
AVHIITAMENRNESRGSHAREDFKDRIDEYDYSMPTSIQEKRKLDEQWRKHTLTFASGDE
GCASIKYRELIEKTLDDQLAYIPPAIRTN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacattgtatgtgccaaaaggccgagttgtctgtgaactggatcatcggaatggaatg
tccttttcccgcacggaaaacggcaaaatctatcagcgaccctttggcggtcagactctg
gactatggcaaaggcggtgtggcaaggcgggtttgttgtgtggccgatcgtacgggacac
tctgtcatacacactctctatggccagaccttgtttcatatttatgaagaccaatgccat
tattatgtggactattttgttctcgatctaattatgtgtgagtgcactagtgtgggctgt
ttggcctggaagctgaacgttggaacctttcatcgatttatgggcaagaatacggtgatt
gcaactaggagatgtgcactggagatggcactgccgcgtcaacagctgcgtctacaggac
atggaatttgtgcaatttcatccaactggaatatacggagccggaggtgtttgcagcgag
ggaggattctttgttaacgagaagggcgaacgtttcatggagcgttatgcccccgaggcc
aaagatctggcctatctcgatgtggtagctcgtgccatggctatggaagtgctaaatggt
aatggttgtggtcccctcaaggatcatgtacacctgcatctgcatcacattgatgctagg
ataatacgtgaacgattgccaggtataatggcaactgcgagaatttttgccaaagtcgat
gtgaccaaggaaccagtcccagtattgttaactgtgcattatactatgggcggcataccc
accacttatatgggacgtgttcttacccggagcagccaggacgaaggccaagacgaaatt
gtagccggtctctatgcctgtggcgaggcggcatgcgcatctgttcatggggcaaatcgt
ttaggtgccaatttactgctcgacctaatcgtgtttggacgtttgcgtgccctggacatt
gctgccaacaattgtccgggcgaagagattccggcaatcgatgagaatgccactaagtag
tcaatgaataatttcatatttgccgatggcaaaataccgacggctgttatacgtctcgaa
cagcaacggacactgaccaaacatgcagccgtatttcgtgagggtaaattgctcaaggag
ggactagacaaggtggccgagttatgtcagcaactcaaggatgtgaaagttttcgatagg
actctaatatggaataccgatctggtggagactctagaattgcagaatatgctggccaat
gcagttcacataatcacagctatggagaaccgcaatgaatcgcgtggttcgcatgctcgc
gaggatttcaaggaccgtatagacgaatatgactacagtatgcccacatcgatacaggaa
aagagaaaactggatgagcagtggcgtaagcatacgttgacattcgccagcggcgatgag
ggttgcgcctctattaaatatcgtgaacttattgaaaagacactggatgatcaattggct
tacataccgccggcaatacgaacaaattaa

DBGET integrated database retrieval system