KEGG   Drosophila willistoni: 6645945Help
Entry
6645945           CDS       T01067                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dwi  Drosophila willistoni
Pathway
dwi00480  Glutathione metabolism
dwi00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6645945
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    6645945
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     6645945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 6645945
NCBI-ProteinID: XP_002068564
FlyBase: FBgn0222352
UniProt: B4N5B1
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MSNGRHLAKGSPPPEVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTEKPDW
LYDKNPQGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIES
FNPVLGAFFKASDGGDMEPFWSGLDVYEKELGRRETLFFGGEQTGILDYMIWPWLERLEL
LKLQRGEDYNYDKQRFPQLTQWLERMKRDAAVMAFYMEAEVQAEFLRTRSAGKPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggcagacatttggctaagggttcccctccgccggaggttccggaggatggc
atcttgcgtttgtattccatgcgcttctgcccatttgcgcagcgagtgcatcttgtgctg
gatgccaaacagataccctatcacagcatctacattaatctcacagagaaaccagattgg
ctgtacgacaagaatcctcagggtaaggtgccagctttggaattggtgcgtgaaccgggt
ccaccagtgttgactgaatcgttgctcatatgcgagtacctggacgagcagtatccactg
cgtccactctatccgcgggatccgctcaaaaaggtgcaggacaaattattgattgaaagc
tttaatccggttctgggtgcgttctttaaagcatctgatggcggcgacatggagcctttc
tggtccggtttggatgtttatgagaaggagctaggtcgtcgggaaacattatttttcggg
ggcgaacaaacgggcatcttggattacatgatatggccttggctggaacgtttggagttg
ctaaagttgcaacgtggcgaggactataactacgataagcaacgctttccccagctgaca
caatggctggagcgtatgaaacgggatgccgctgtgatggccttctacatggaagccgag
gtgcaagcggaatttttgcgcacacgcagcgccggcaaacccaactacaatctcctggtg
aaagatgcttga

DBGET integrated database retrieval system