KEGG   Drosophila willistoni: 6646274
Entry
6646274           CDS       T01067                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X1
  KO
K20017  Bcl-2 family protein
Organism
dwi  Drosophila willistoni
Pathway
dwi04214  Apoptosis - fly
dwi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6646274
   04215 Apoptosis - multiple species
    6646274
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6646274
NCBI-ProteinID: XP_002068714
FlyBase: FBgn0219877
UniProt: B4N5R1
LinkDB
Position
Unknown
AA seq 307 aa
MFPLGGYFQMPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVG
QRDVTATRRRLSNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLF
NKKLGFQRIRSIMGSTSMGVVRDVFPAVQVLGDELERMHPRVYNGVARQICRNPGGEFQS
SDAVSLLIGAVGRELFRVDITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIE
DELVPWINDNGGWSGINTHVLPTTNSLNPLEWTTLIIGVVFGFILIFMFLRFIISTLIPK
IYQRFTS
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtttcctttaggtggatacttccaaatgcctggcacttcgtatcccacaaataatgat
aatttcagcaacggttttcccatggccaccactcaaagtgaacgattgctgcaggctcag
aatcgtaggaaattcagttttccggctaccctacattccgcatcgcttctggaggtgggc
caaagggatgtcacagcgacgcggcgtcgtctgagcaatgtcagtgatgtggtcacaagg
aaactatcctataccattggctggaaggcggcacaaattccagcccaggatatcataact
cagggacgttgtctttgtggccattatatcaagaggcgtttaagacgctcgggtttgttt
aataagaaattgggtttccagcgtattagaagtattatgggttccacatcaatgggcgtg
gtacgtgatgtctttccagctgttcaagtgttgggtgatgagctggagcgtatgcatcct
cgtgtctataatggtgtggccaggcaaatctgtcgcaatcctggtggtgaatttcaaagt
tctgatgctgttagcctgttaataggcgccgtgggtcgagaactatttcgcgttgatatc
acctggagcaaggtcatctctttatttgccattgccggtggtctatcggtggactgtgtt
cgtcaagggcatccggaatatttgcccaaactaatggagagtgtatccgaggtcatcgaa
gatgagctagtaccctggatcaatgataatggtggttggagcggcatcaatacccatgtc
ttacccacaaccaacagtctcaatcctttagaatggaccacattaataattggtgtggtt
tttggttttattttaattttcatgttcttacgtttcattataagcacgctaatacccaaa
atatatcaacgattcacaagttga

DBGET integrated database retrieval system