KEGG   Drosophila willistoni: 6647225Help
Entry
6647225           CDS       T01067                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dwi  Drosophila willistoni
Pathway
dwi00040  Pentose and glucuronate interconversions
dwi00051  Fructose and mannose metabolism
dwi01100  Metabolic pathways
Module
dwi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    6647225
   00051 Fructose and mannose metabolism
    6647225
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     6647225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 DUF3530 2-Hacid_dh_C Sacchrp_dh_NADP Pyr_redox
Motif
Other DBs
NCBI-GeneID: 6647225
NCBI-ProteinID: XP_002070810
FlyBase: FBgn0214264
UniProt: B4NAA9
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MAKDNLTAVLHGIEDLRLEQRPIPEIGDDEVLLAMDSVGICGSDVHYLQHGRIGPFVLTK
PMIIGHEAAGVVAKIGKKVTNVKVGDRVAIEPGVPCRYCDHCKQGRYHLCPDIVFCATPP
YDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRGGVGLGSKVAILGAGPI
GLVTLLTAQSMGASEILITDLVQSRLDVAKELGATHTLLLTKEQSAEDTVKLVTQKMSAQ
PDVTIDCCGAESSVRLAILATRSGGVVVVVGMGAPEVKLPLINALAREVDIRGIFRYCND
YSAALALVSSGKVNVKRLVTHHFDIKETAKAFETSRHGLGGAIKVMIHVTPRNTNNPVKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggataatttaacagcagtgctacacggtattgaggatctgcgtttggagcaa
cgtcccataccggaaattggcgacgatgaggtccttcttgccatggatagtgttggcatt
tgcggttctgatgttcactatctgcaacacggacgcattggtcctttcgttttaaccaaa
cccatgatcattggccacgaagctgctggcgtggtggctaaaatcggcaagaaggtcaca
aatgtgaaagtgggcgatcgtgtggccatcgaacccggtgtaccctgtcgttattgtgat
cactgcaagcagggcagatatcatctttgccccgacatcgtattctgtgccactcccccc
tacgatggcaatctcacgcgctattacaaacatgctgccgatttttgcttcaaactgccc
gatcatgttagcatggaggagggagcgttgttggaaccactctcggtgggtgtgcacgcc
tgtcgtcgtggcggtgtgggcttgggatcaaaggttgccattctgggagccggacctatt
ggattggtgacgttgttgactgcccaatcgatgggagcttccgagatattgattacagat
ctggtacaaagtcgtttagatgtggccaaagagcttggcgccacacatactttgctcttg
accaaggaacaaagtgccgaggatacggttaaattagtgacacaaaaaatgagtgctcaa
ccggatgtgaccatcgattgctgtggagcagagagcagtgttcgattggccattttggcc
acacgttcgggtggtgtagttgttgtagttggaatgggagcaccggaagttaagttgcca
ttgatcaatgcgctggcccgtgaagtggatatacgtggcatattccgttactgcaatgat
tactctgctgctttagctctggtgtcttcgggcaaagtgaatgtcaagcggttggtcacc
catcattttgatatcaaagagacggccaaagcctttgaaacatctcgacatggccttggc
ggagccataaaggtcatgatccatgttacaccgcgtaacaccaacaatcctgtcaaattt
taa

DBGET integrated database retrieval system