KEGG   Drosophila willistoni: 6647494Help
Entry
6647494           CDS       T01067                                 

Definition
(RefSeq) chymotrypsin-2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dwi  Drosophila willistoni
Pathway
dwi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6647494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dwi01002]
    6647494
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    6647494
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     6647494
Peptidases and inhibitors [BR:dwi01002]
 Serine peptidases
  Family S1: chymotrypsin family
   6647494
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6647494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6647494
NCBI-ProteinID: XP_002070706
FlyBase: FBgn0214212
UniProt: B4N9L6
LinkDB All DBs
Position
Unknown
AA seq 260 aa AA seqDB search
MDLPVLYPPQYTNNRIVGGEEAAMGVAPYQISLQGTKSGQHSCGGAIIDERWIVTAAHCT
RGRKASDFRVLTGSQILNQNSSKFYYPDKIVEHCNYAPRKFRNDIALMHLNDSIVFDNAT
QKVELDHEPLVPGSKLLLTGWGTLSLGGEVPSRLQSLEVTYVPFEQCRAAHDNSSRVDIG
HVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKGYPDAHASISYYHDFIRTHLS
VDETSAEDEEDMMKGNNGHC
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggatttgccggttctatatccaccacaatatacaaataatcgtattgtgggcggcgaa
gaagccgctatgggtgtggcaccctatcaaatctccctgcaaggcacaaaaagcggccaa
cattcgtgtggtggagcgattatcgatgagcgttggattgtcactgccgctcattgcaca
cgaggcagaaaagccagtgattttcgtgttttaaccggaagccaaattctaaatcagaat
agttcgaaattttactatcccgacaagattgtagagcattgcaattatgcgcccagaaaa
ttccgtaatgacattgctttgatgcatctgaatgattcaattgtttttgacaatgccaca
caaaaggtcgagttggatcacgagcctttggtaccgggttccaagctattgcttaccggt
tggggcactctatcgttgggcggtgaagtgccctctcgccttcagagcttggaggtgact
tatgtgcccttcgaacagtgtcgtgctgcccatgataatagcagtcgagttgatattgga
catgtttgcaccttcaatgacaagggcaggggagcctgtcatggcgattctggtggccca
ttggtccacaatggcaaactggtggctctggtcaattggggcttaccttgtgccaaagga
tatccagatgctcatgcttctatttcatactatcacgactttattcgcactcatttgagt
gtagatgagacatccgcagaggatgaggaggatatgatgaaaggaaacaatgggcattgc
taa

DBGET integrated database retrieval system