KEGG   Drosophila willistoni: 6648805
Entry
6648805           CDS       T01067                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X1
  KO
K16679  wengen
Organism
dwi  Drosophila willistoni
Pathway
dwi04013  MAPK signaling pathway - fly
dwi04214  Apoptosis - fly
dwi04215  Apoptosis - multiple species
dwi04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6648805
   04391 Hippo signaling pathway - fly
    6648805
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6648805
   04215 Apoptosis - multiple species
    6648805
SSDB
Motif
Pfam: TNFR_c6 PhoR PspB
Other DBs
NCBI-GeneID: 6648805
NCBI-ProteinID: XP_002071808
FlyBase: FBgn0226914
UniProt: B4ND85
LinkDB
Position
Unknown
AA seq 334 aa
MPTRRWRSLTDFSLMLLISTASSVACVAAAASAASSAAVTGSSASAVTASPTSSIAHTSF
SSSSSSSSPCAPHHWWDAMQDKCIPCTSCQGEMIPLRPCQLHTDTICGSIYDLKIDWVVL
AKTEPNWKERRKSSSSSEYEHFEQSQSHKLAQSTLQHLTHEQLQQLHDEAAAAWALDWPT
SIFYIAVLFCLIFFTVAAGILIHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQSLDGGT
FFIGNADALRGLPVTAAVTAAQGGGTTMSGHHHHHHHRHFLHSSTGLPSGGVGIFQPQHV
LLPDKHHGKHHQQERRILKTLQPGNVYIEENNKG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgccaacgagaagatggagaagtctaaccgattttagcttaatgctattaatctccact
gcctcttcagttgcctgtgttgccgccgccgcctccgccgcatcctccgccgcagtcaca
ggatcctccgcctcagcagtgactgcatcccctacatctagtattgctcacacaagtttt
agctccagctcaagttctagctcaccatgtgctccgcatcattggtgggatgccatgcag
gataagtgtataccctgtacaagttgtcagggtgagatgataccattgcgaccatgtcaa
ttgcatactgatacaatatgcggttccatctatgatttgaaaatcgattgggttgtcctg
gccaaaactgagcccaattggaaagagcgccgaaagtcgtcatcatcctctgagtatgag
cactttgaacaatcccaatcgcataagttggcccagtcgacattgcagcatttgacccat
gagcaattgcagcagctgcacgatgaggcagcagctgcctgggcattggattggccaacg
agtatcttctatatagccgtattgttctgtttgatcttctttacggttgccgccggcata
ctcattcatcatatgcgtcaatggcgtcgcatggaaaggcgtttagatcaagatgtggaa
gagttgtccacaaaactgatggccaaattggctgaagtgcagagtttggatggtggcaca
tttttcattggcaatgccgatgccctcaggggtctgccggtcacggctgctgttacagct
gcccagggaggtggcacaacgatgtcagggcaccatcaccatcatcatcatcgtcatttt
ctgcattcctcgactggcctaccgtcgggtggtgttggcatctttcagccgcagcatgtg
ctgttgcctgacaaacatcatggcaaacaccatcaacaggagcgacgcatattgaaaacc
ttacagccgggcaatgtctacatcgaggagaacaataagggttaa

DBGET integrated database retrieval system