KEGG   Drosophila willistoni: 6652113
Entry
6652113           CDS       T01067                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dwi  Drosophila willistoni
Pathway
dwi04214  Apoptosis - fly
dwi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6652113
   04215 Apoptosis - multiple species
    6652113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dwi01002]
    6652113
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6652113
Peptidases and inhibitors [BR:dwi01002]
 Cysteine peptidases
  Family C14: caspase family
   6652113
SSDB
Motif
Pfam: Peptidase_C14 B5
Other DBs
NCBI-GeneID: 6652113
NCBI-ProteinID: XP_002074856
FlyBase: FBgn0225242
UniProt: B4NNA3
LinkDB
Position
Unknown
AA seq 330 aa
MTDECITRNFSLLNRSNSGGSSNGQTKSNRSSIIDNTDAKGCMEGSSGGATGTGSGVPSS
INKYVARMPVDRYASEYNMNHKYRGQAIIFNHEFFDIPSLKSRAGTNVDAEELRKALKSL
GFDVSVHKDCKLRDILKYIDKAASLDHTDNDCIAIAILSHGEHGYIYAKDVQYKLDAIWH
YFTAHICPTLAGKPKLFFIQACQGDRLDAGVMLEKNGVTETDGESSMSYKIPIHADFLFS
YSTIPGYFSWRNTTNGSWYMQSLIQELNTNGKKYDILTLLTFVSQRVAIDFESNVPSTPL
MDRQKQIPCVTSMLTRILRFTDKPSGNKAG
NT seq 993 nt   +upstreamnt  +downstreamnt
atgacggacgaatgcataaccagaaactttagtcttctcaatagaagcaacagcggtggc
agcagcaatggacaaaccaagagcaatcgcagcagcattattgataacactgacgccaag
ggctgtatggaaggaagcagtggtggtgcaacaggaacgggaagtggtgtgccatcctca
ataaataaatatgtagcccgaatgccagtggatcgttatgccagcgaatataacatgaac
cacaaatatcgcggtcaggctataatctttaatcatgagtttttcgatataccctcgcta
aaatcaagagctggaactaatgttgatgccgaggaactgcgcaaagctctcaagagtctg
gggtttgatgtttcagtgcataaggactgcaaattgagagatattttgaaatatatcgat
aaagccgcctcactggatcatacggataatgattgcatagccattgccattttgtctcat
ggcgaacatggctatatttatgccaaagatgtgcaatataaactggatgccatttggcac
tatttcacagcgcatatttgccccacgttggccggcaaaccgaagttgttctttatacag
gcctgtcaaggcgaccgtttggatgcgggcgtgatgctggagaaaaacggggttactgaa
acggacggcgagtcgtcaatgagctataagatccccatacatgccgacttcctcttttca
tattcaacgataccaggctacttctcctggcgcaatacaacgaatggatcttggtatatg
caatcgcttatccaagagttaaacacaaatggtaaaaagtatgacattctcactctgctc
acttttgttagtcaacgtgtggctattgattttgaatcgaacgtgccctctacaccttta
atggatcggcagaagcaaataccctgcgtcacttccatgctaacgcgcatattgcgtttc
acagataaacctagtggcaataaagctggctag

DBGET integrated database retrieval system