KEGG   Drosophila willistoni: Dwil_GK15671Help
Entry
Dwil_GK15671      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dwi  Drosophila willistoni
Pathway
dwi04013  MAPK signaling pathway - fly
dwi04068  FoxO signaling pathway
dwi04146  Peroxisome
dwi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dwil_GK15671
   04068 FoxO signaling pathway
    Dwil_GK15671
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dwil_GK15671
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dwil_GK15671
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dwil_GK15671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 6640975
NCBI-ProteinID: XP_002063884
FlyBase: FBgn0217676
UniProt: B4MRY1
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MFVARNVTKAARLAVRGKHTLPKLPYEYTALEPIICREIMELHHQKHHQTYVNNLNAAEE
QLQDAKSKSDTTKIIQLGSALRFNGGGHINHTIFWQNLSPEKSTPSEDLKKAIESQWKSF
DDFKKELTALTVGVQGSGWGWLGYNKKTGKLQLAALPNQDPLEASTGLIPLFGIDVWEHA
YYLQYKNVRPSYVEAIWDIANWNDISCRYQEAKKLVA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtagcacgcaacgtaaccaaagcagcacgcctagctgtgcgcggaaagcacacg
cttcccaagctgccctatgagtataccgctctggagcccattatttgccgtgagattatg
gaattgcatcatcagaagcatcatcagacctatgtcaacaatctaaacgctgcagaagag
caactgcaagacgccaagagcaagagcgataccacaaaaataattcaattgggttcggct
ctacgttttaatggcggaggccacattaatcacaccatcttctggcaaaatctgtcacct
gagaagagcactcccagcgaggatctgaaaaaagccatcgaatcccaatggaagagcttt
gacgacttcaaaaaggaactgaccgccttgacagtgggcgttcaaggatctggctggggt
tggttgggctacaacaagaagacaggcaaattgcagttggctgctctgcccaatcaggat
ccacttgaggcatcaactggtttgattccacttttcggaattgatgtttgggagcatgct
tattatttgcagtacaaaaatgtgcgcccttcgtatgttgaggccatttgggatattgct
aattggaatgacatctcgtgccgctaccaggaggccaagaaactagtcgcttag

DBGET integrated database retrieval system