KEGG   Drosophila willistoni: Dwil_GK18893Help
Entry
Dwil_GK18893      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11253  histone H3
Organism
dwi  Drosophila willistoni
Brite
Chromosome and associated proteins [BR:dwi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dwil_GK18893
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK18893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 6646542
NCBI-ProteinID: XP_002069215
FlyBase: FBgn0220891
UniProt: B4MHK1
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaagcaaactgctcgaaaatcgactggtggcaaggcgccaaggaagcag
ctggctactaaagcagcacgtaagagtgctccagcaaccggtggtgtaaagaaaccacat
cgttaccgtcccggtactgttgccctccgtgaaatccgtcgttaccagaagagcacagaa
ctgctcattcgcaaattgccattccagcgtttagtgcgtgaaatcgctcaggactttaaa
accgacttgcgtttccagagttctgcagttatggctttacaagaagctagcgaagcctat
ttggttggcctatttgaagatactaacttgtgtgcaatccatgccaaacgagtgaccata
atgcctaaggatattcaactagccagacgtattcgaggcgagcgtgcttaa

DBGET integrated database retrieval system