KEGG   Drosophila willistoni: Dwil_GK19806Help
Entry
Dwil_GK19806      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dwi  Drosophila willistoni
Pathway
dwi00480  Glutathione metabolism
dwi00980  Metabolism of xenobiotics by cytochrome P450
dwi00982  Drug metabolism - cytochrome P450
dwi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dwil_GK19806
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK19806
   00982 Drug metabolism - cytochrome P450
    Dwil_GK19806
   00983 Drug metabolism - other enzymes
    Dwil_GK19806
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dwi02000]
    Dwil_GK19806
Enzymes [BR:dwi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dwil_GK19806
Transporters [BR:dwi02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dwil_GK19806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_2 GST_N GST_N_3 GST_C_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 6641436
NCBI-ProteinID: XP_002064241
FlyBase: FBgn0221804
UniProt: B4MSY8
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MSTAAPGPGPAPAPSPVHYYYDLMSQPSRALFIIFRLSGMPFQDCVVALRNGEHLTDEYK
TNINRFQRVPCINDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQARVDEFLEWQHMT
LRITCALYFRTVWLEPLLTGRTPKEDKIEKLRMQMELNLDVIEDVWLQNSDFVSGSTLTA
ADIFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQTCNPHYDVAHEFVYKISGTGPQAKL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcagctcccggtccaggaccagctccggctccaagtcctgtgcattactac
tacgacttgatgtcacagccctcgagggctttgtttatcatcttccgcttaagtggcatg
ccattccaggattgtgtggtcgctttaagaaacggtgaacacttgaccgatgagtacaaa
acgaacataaatcgcttccagcgtgttccctgcatcaatgacaatggctacaagctggcc
gagagtgtggccattctaagatatttgagtgccaagggcaagatacccgagcatctgtat
cccaaatactttgtggatcaggctcgggtcgatgagttcctcgaatggcagcacatgacc
ctgagaataacctgtgccctctactttcgcactgtttggctggagcccttactgacgggt
cgcacgccgaaagaggataagattgagaagctgcgcatgcaaatggaactcaatctggat
gtcattgaggatgtgtggctacagaatagtgacttcgtgtcaggatccaccctaacagcg
gctgatatattcgctgcttgtgaaattgaacagacacgcatggccgactatgatgtccgc
atcaagtatcccaagatacgggcctggctgaaacgtgtccgccaaacgtgcaatccgcat
tatgatgttgcccacgagtttgtctacaagatctcgggaacgggaccacaagccaaactc
taa

DBGET integrated database retrieval system