KEGG   Drosophila willistoni: Dwil_GK20737Help
Entry
Dwil_GK20737      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dwi  Drosophila willistoni
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dwi01002]
    Dwil_GK20737
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dwi04147]
    Dwil_GK20737
   04090 CD Molecules [BR:dwi04090]
    Dwil_GK20737
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dwil_GK20737
Peptidases [BR:dwi01002]
 Metallo Peptidases
  Family M2
   Dwil_GK20737
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK20737
CD molecules [BR:dwi04090]
 Proteins
  Dwil_GK20737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF1365
Motif
Other DBs
NCBI-GeneID: 6638145
NCBI-ProteinID: XP_002061416
FlyBase: FBgn0222733
UniProt: B4MJW3
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MWLQGWLLLLPILLGLANIINASTAGNHTLNYEAKTQRILDRATQRIRSIYDMKRRIFLQ
LTLKGKSPLGGQAPSKLEVEMETYRLLYEVAANLSVVPVEQLSDPLMRRRVQRLSKLQLQ
GLRPADYEQAKDLLRTMHNFVNGPLVCPGEDCSARKPLAMYPQIMNMNMRTKNYKDLLEN
WVNWRRTINDKITAKNTFIDYVRLLRIAATYNGHVTPSRTWYLYYDTENFQAELEAVVWE
IMPLYRELHGYLRHEVQRAYPKADMKNDGAISAPIMDQILSQDWYSHQFFQTPHPSKEHQ
LPSVVRRLEEVLVTPVKINKKATEFFESLGLNHMSDGFYDRYARRMNDDEGGPDCKPQVY
YFPPDVALRYCPKLDYKKMMQVHGVMCELQYNLYKRNLPFGLDSEPCPGFGNALAETAVL
ASGTPRHLHRLHILLNESLTEEQSLNRLFRMGVHTLLAVPQYFINDKFLVDVMDGRIVVK
DYNCAYWNLQDKYAGVQAPLWRTAKDFDPDFKFYRGLNPETSNTKKFLAEILGFQFYRSF
CLASGQYKPGDPKFPLHNCDFYDSKAAGKMIKDMMEFGSTKHWRDIMEIATGERKLSGRG
VLEYFAPLFTWLKERNKQLDIEPGWDAEDFCPKE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggttacagggttggcttcttttgctgccaattctgttgggtttggctaatattatc
aatgcctccaccgctggaaatcatacgctaaactatgaagcgaaaactcaacggatttta
gatcgagccacccaacgaatacgttcaatatacgatatgaagcgacggatttttcttcaa
ctaacattaaagggaaaatcgccgcttggtggccaggcacctagtaaattggaggtggaa
atggaaacctatcgtttgctctatgaggtggccgccaatctcagcgtggtgccagtggag
caactctcagatcctttaatgcgtcgcagggttcaacgtttgtccaagttgcaactgcaa
ggactacgtcctgcagattacgaacaggccaaggatttgctaagaactatgcataatttt
gtaaatggtcctttggtttgtccaggagaagattgctcagctcgtaagcccttggccatg
tatccacagattatgaacatgaatatgagaacgaaaaactataaagatttattggagaac
tgggttaactggcgtcggacaatcaatgacaaaataacggccaagaacacgttcatagac
tatgtgcgattgctgcgtattgcagccacgtataatgggcacgttacaccatctcgtact
tggtatttgtactacgatacagagaacttccaggccgaactggaggcagtggtgtgggag
ataatgccactgtatagggaacttcatggctatttgcgacacgaagtgcagcgtgcctat
cccaaggcggatatgaaaaatgatggtgccatatcggcgccaataatggatcaaatctta
tcacaggattggtattcccatcaatttttccaaacaccacatccaagcaaagagcatcaa
ttgccatcggtggtaagacgacttgaagaggttcttgtgactcccgtaaaaatcaataaa
aaggcaactgaattcttcgaatctttgggtctcaatcatatgtccgacggcttctatgat
cggtatgctcgacgcatgaacgacgatgaaggcggtcctgattgtaagccacaagtttac
tattttccacctgatgttgccttgagatattgcccgaaattggactacaagaagatgatg
caagtccatggtgttatgtgcgaattgcaatataatctttataaacgaaatctgccattt
ggtctggactcggaaccttgtccaggatttggtaatgctttggctgaaacagctgtcctt
gcctcgggcacaccaagacatttgcatcgtctgcatattctgctcaacgaaagccttacc
gaagagcaatccctaaatcgtctcttccgcatgggtgtccacactctgctagctgttcct
cagtactttatcaatgacaagttcctcgtcgatgtcatggacggacgcattgttgtgaag
gactacaattgtgcctactggaatcttcaagataaatatgccggcgtccaagccccactg
tggcgtacggccaaagattttgatcctgatttcaaattctatcgtggtctcaatcccgaa
acttcgaataccaaaaaatttttagcggaaattcttggttttcagttctatcgttcattc
tgtctggccagtggacaatacaagccaggagatcccaaatttcctctacacaattgtgat
ttctatgacagcaaggcggctggtaaaatgataaaggacatgatggaatttggctcgaca
aaacattggcgtgacataatggaaatagccacaggcgaacggaaactgagtggacgcggc
gtattagaatactttgccccgctcttcacctggctcaaagagcgtaataaacaattggac
attgagcctggctgggatgccgaagatttttgtcccaaggaataa

DBGET integrated database retrieval system