KEGG   Drosophila willistoni: Dwil_GK21504Help
Entry
Dwil_GK21504      CDS       T01067                                 

Gene name
Dwil_Mal-A4
Definition
(RefSeq) maltase A4
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dwi  Drosophila willistoni
Pathway
dwi00052  Galactose metabolism
dwi00500  Starch and sucrose metabolism
dwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dwil_GK21504 (Dwil_Mal-A4)
   00500 Starch and sucrose metabolism
    Dwil_GK21504 (Dwil_Mal-A4)
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dwil_GK21504 (Dwil_Mal-A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 6640223
NCBI-ProteinID: XP_002063226
FlyBase: FBgn0223496
UniProt: B4MQ23
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MATWSGIVFLLVVGLLAVDAADPWWKTASFYQIYPRSFKDTNGDGVGDLNGVTEKLEYLK
EIGITATWLSPFLKSPMADFGYDIADFKEVDPLFGTMEDFENMVARAKELNVKIILDFVP
NHSSDECDWFIRSANGEEKYKDYYIWHPGFVDEDGVRRPPTNWVSVFRGSAWEWNENRQE
YYLHQFHKKQPDFNFRNPVVREEMNDVLRFWLGKGVDGFRVDAIYHAFEVEADEDGNYPD
EPRNDWTDDPDEYGYTHKIYTVDQPETPHLVYEWRQILEQFQADNGGDERILMVETWSPI
EIVMDYYGNSTADGAQIPFNFQLISNLYYDSDAYHYEYLINNWLTLMPEGKSANWVIGNH
DKNRVGSRFGADRVDLFNILLLTLPGCSITYNGEELGMLDGYVSWEDTVDPQACNGYEAN
YMDNSRDPARTPMHWTDDKYAGFTNGSTTWLPVALDYAQRNVKKERGVSLSHLNVYKRLQ
ELRKEPTISGGAGEIKAVSSYVLAVKRLVV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccacttggtctggcatcgtctttttactggtcgttggcctgctggccgtcgatgca
gctgatccatggtggaaaacagcctcgttctatcagatatatccgcgatccttcaaggat
accaatggcgatggtgtcggtgatctgaacggtgtgacagagaaattggaatatcttaaa
gaaattggaataacagcaacttggctatcgcccttcctgaaatcaccaatggctgatttt
ggttatgatattgcggattttaaagaagttgatcctctattcggtacaatggaggacttt
gagaacatggtggcacgtgccaaggaattgaatgtgaaaatcattttggactttgtgccc
aatcattcgagtgatgagtgtgattggtttatccgatcggcaaatggtgaggagaagtac
aaggactactacatctggcatccaggatttgttgatgaagatggcgtgcgtcgtcccccc
accaattgggtgagcgtgttccgtggctccgcctgggaatggaatgagaatcgccaggaa
tactatctacatcagttccataaaaagcaaccggatttcaatttccgtaatcctgttgtg
cgtgaggaaatgaatgatgtactgcgattttggttgggcaagggtgttgatggtttccgt
gtcgatgccatctaccacgctttcgaggtggaggctgacgaagatggcaattatccggat
gagccacgcaatgattggaccgatgatccagatgaatatggttatacgcataagatatat
actgtggatcagccagagacacctcacttggtttacgaatggcgacagattttggaacaa
ttccaggccgataatggcggcgatgagcgtattctaatggtggagacatggtcgcccatt
gaaattgttatggactattatggcaactcaacagctgatggtgctcagataccgttcaat
ttccagctgataagtaatctctactacgattccgatgcttatcactatgagtatttgatt
aacaactggctaacactaatgcctgagggtaaaagcgccaactgggtgattggcaatcat
gacaaaaaccgtgtgggttcgcgttttggagccgatcgtgtcgatctcttcaatatacta
cttcttaccctgcccggctgtagtattacctacaatggcgaagaactgggcatgctggat
ggttatgtatcgtgggaggatacagtagatcctcaagcttgcaatggctatgaggccaac
tatatggacaattctcgggatccggcccgtactcccatgcattggacagatgacaaatac
gccggtttcaccaacggctcgacaacctggttgcccgtggccctggattatgctcagcgc
aatgtgaagaaggagcgcggtgtttctctcagccatctcaatgtgtacaaacgtctgcag
gaactcagaaaagagcccaccatatcggggggagcgggtgaaatcaaggcagtcagcagt
tatgttttggctgtcaaacggttagttgtttaa

DBGET integrated database retrieval system