KEGG   Drosophila willistoni: Dwil_GK21886Help
Entry
Dwil_GK21886      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dwi  Drosophila willistoni
Pathway
dwi04146  Peroxisome
dwi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dwil_GK21886
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dwil_GK21886
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dwil_GK21886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 6640516
NCBI-ProteinID: XP_002063399
FlyBase: FBgn0223871
UniProt: B4MQJ6
LinkDB All DBs
Position
Unknown
AA seq 216 aa AA seqDB search
MLRLLAITLALCASMCAAAQTRATPMEAIAYVIGPVQEDNSQVKGNVTFIQNDCGQNVHV
RILLTGLKEGKHGFHIHEKGDLTNGCTSMGAHYNPQKVDHGGPDHEVRHVGDLGNVAVNS
TGILDVTITDSVLSLTGKHTIIGRGVVVHEDEDDLGLGNHTDSKKTGNAGGRVACGVIGV
NSDIDEWPCREGGAGALTISYTILMFMAALILAPGM
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcttttggcaattaccctggccttatgtgcctcaatgtgtgcggctgctcaa
actcgtgctaccccaatggaggccattgcctatgtgattggacctgtgcaagaggataat
agtcaagtcaagggcaatgtaaccttcattcagaatgattgtgggcaaaatgttcatgtg
cgcattctattgactggcctgaaggagggcaaacatggtttccatatacacgagaaggga
gatctgaccaatggctgcaccagcatgggagctcactacaatccacaaaaggtggatcat
ggtggtcctgaccatgaagtgcgtcatgttggcgatttgggtaatgtggcagtgaactcc
actggcattttggatgtgactattaccgattccgtgttgagtttaactggcaaacacacc
attattggacgcggtgtggttgtccatgaagatgaagatgatttgggtcttggtaatcat
acagattccaaaaagactggcaatgcaggcggaagagttgcctgcggagttattggtgtc
aactcggatattgatgaatggccctgtagagaaggtggagctggtgctttgactatctca
tataccattttgatgttcatggcggccctaatccttgcacctggcatgtag

DBGET integrated database retrieval system