KEGG   Deinococcus wulumuqiensis: DVJ83_04835Help
Entry
DVJ83_04835       CDS       T05579                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dwu  Deinococcus wulumuqiensis
Pathway
dwu00620  Pyruvate metabolism
dwu00680  Methane metabolism
dwu01100  Metabolic pathways
dwu01120  Microbial metabolism in diverse environments
dwu01200  Carbon metabolism
Module
dwu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DVJ83_04835
  09102 Energy metabolism
   00680 Methane metabolism
    DVJ83_04835
Enzymes [BR:dwu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DVJ83_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXG98601
UniProt: A0A345IFX9
LinkDB All DBs
Position
complement(976853..979342)
Genome map
AA seq 829 aa AA seqDB search
MALNNDVNRLGRILGQVLKEQEGEAFFDLVERTRALVRDVRSGGDPAELNALLSGLSEHD
ASNLTRAFTWYFQLVNIAEEYERVRVLQSRSGVRAQSLAQALADLKAQGLSAEETEALLA
RVELELTFTAHPTEMRRRTVRSHLEDVARELPDLERESAQERVAAHVEALWRTPELRRLR
PTVLDEVKGGLNYISTIAEALPKLERDLSGAFREVYGRETAAHVPLRFSSWMGGDRDGNP
FVTPEATREALHLHRERARELLLAAIRRAYTDLSQEEEEDAAEGSYRAELRTLHDAVRDG
ERVELLPRLEALNARLHAEGQARTARHLLMPLLSAARVFGQHLVSLDIREHSGQTGAAVA
ELLRAAGVEADYLALSEDAKLQVLTRELRSRRPLWPAGEALTEPLETVVGPIREVQAAAR
QVGERAFGHYVISMAESVSDVLEPLLLAREVGFRVLPVPLFETLDDLQRAPQIVRDLLSL
PEYRAVLSDDLQEIMLGYSDSNKDAGFLAANWALHEAQRKISDVCRRAGVRWRFFHGRGT
SIGRGGGPASRAILGQPAGTIDAGVRITEQGEALADKYSHPVLARRNLEQALYGVLLAAA
RPAGDPPADFMAAMTRAAEASAAAYRAFVQDPEFLAFFERVTPIHEISRLNIASRPVRRA
GAPSLQNLRAIPWVMSWTQNRANLPGWYGLAEGLDEIGPELAARMYAEWPFFRSMLGNAQ
MSLAKSDPLVFAEYLTLLGTDGHRLADHVRSSYARTVAAVERVVGGELMANEPRLKETIA
LRNPYIDPIHRLQVELLRRSRSREGGLDEYERPLLLTLQGIAAGVRNTG
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaacaacgatgtcaaccgcctgggccgcatcctgggtcaagtcctgaaagag
caggagggcgaggcgtttttcgacctcgtcgaacgcacccgcgccctggtgcgcgacgtg
cgctccgggggcgaccccgccgaactgaacgcgctgctttcgggcctcagcgaacatgac
gcctccaacctcacgcgggcgttcacgtggtacttccagctcgtcaacatcgccgaggaa
tacgagcgggtgcgggtgttgcagagccgcagcggcgtgcgggcgcagagtctggcgcag
gccctcgcggacctcaaggcgcagggcctgagcgccgaagagaccgaggcgctgctcgcc
cgcgtggaactcgaactcaccttcaccgcccaccccaccgagatgcgccgccgcaccgtg
cgctcgcatctggaagacgtcgcccgcgaattgcccgacctggagcgcgaatcggcgcag
gaacgggtggcggcgcatgtggaggcgctgtggcgcacgcccgagctgcggcgactgcgg
cccaccgtgctggacgaggtcaagggcggcctcaactacatttccacgattgccgaggcg
ctgcccaaactggagcgcgacctgtcgggggccttccgcgaggtgtacggacgcgagacg
gcggcgcacgtgccgctgcgcttctcgtcgtggatgggtggggaccgcgacggcaacccc
ttcgtgacccccgaggccacccgcgaggcgctgcacctgcaccgcgagcgggcgcgggag
ctgctgctggcggccattcgccgggcctacaccgacctcagccaggaggaagaggaggac
gccgccgaagggtcctaccgcgccgagttgcgcaccctgcacgatgcggtgcgtgacggg
gagcgggtcgaacttttgccgcgtctggaagccctgaacgcccgcctgcacgccgaggga
caggcccgcaccgcccggcacctgctgatgccgctgctgtcggcggcccgcgtgttcggg
cagcatctggtcagcctcgacatccgcgagcattccgggcaaacgggcgcggcggtggcc
gaactgctgcgggcggcgggcgtggaggccgattacctcgcgctgtccgaagacgccaag
ctgcaggttctgacccgcgaactgcgctcgcgccgcccgctgtggcctgcgggcgaggcg
ctgaccgagccgctcgaaacggtcgtcggccccatccgcgaagttcaggcggcggcgcgg
caggtgggcgagcgtgctttcgggcactacgtcatctccatggccgaaagcgtcagcgac
gtgctggagccgctgctgctggcccgcgaggtgggttttagggtgctgcccgtgccgctg
ttcgaaaccctcgacgaccttcagcgtgcgccgcagattgtccgggacctgctctcgctc
cccgagtaccgcgccgtgctgagcgacgacctccaggaaatcatgctcgggtactccgac
tccaacaaggacgcgggctttctggcggcgaactgggccttgcacgaggcgcagcgcaag
atcagcgacgtgtgccgccgggcgggggtgcgctggcggtttttccacgggcgcggcacc
tccatcgggcgcgggggcgggccagcgagccgggcgattttggggcaacccgccggaacc
atcgacgcgggcgtgcggattaccgagcagggtgaagccctggccgacaagtacagccac
ccggtgctggcgcggcgcaatctggaacaggccctgtacggcgtgctgctggcggcggcc
cggcccgcaggtgacccccccgccgacttcatggcggccatgacccgcgccgcagaagcg
agtgcggcggcctaccgcgccttcgtgcaggaccccgagttcctggcctttttcgagcgg
gtcacgcccattcacgaaatcagccgcctgaatatcgcctcgcgcccggtgcgccgcgcc
ggagcgccctcgctgcaaaacctccgcgccattccctgggtgatgagctggacgcaaaac
cgcgccaacctccccggctggtacgggctggccgaggggctggacgaaatcggcccggag
ctggctgcccgcatgtacgccgagtggccctttttccgctccatgctgggcaacgcgcag
atgagcctcgccaagagtgacccgctggtgttcgccgagtacctgacgctgctgggcacg
gacgggcatcgtcttgccgaccatgtgcgcagcagctatgcccgtacggtggcggcggtc
gaacgtgtcgtgggcggcgaactgatggcgaacgagccgcgcctgaaagaaaccatcgcg
ctgcgaaatccctacatcgaccccattcaccgcctgcaggtcgaactgctgcgccgctcg
cgctcacgcgaaggcggcctggacgagtacgagcgcccgctgctgctcacgcttcagggg
attgcggcgggggtgcggaacacgggctga

DBGET integrated database retrieval system