KEGG   Deinococcus wulumuqiensis: DVJ83_06140Help
Entry
DVJ83_06140       CDS       T05579                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dwu  Deinococcus wulumuqiensis
Pathway
dwu00564  Glycerophospholipid metabolism
dwu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dwu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DVJ83_06140
Enzymes [BR:dwu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DVJ83_06140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like NAD_binding_8 GIDA Pyr_redox_2 Thi4 Pyr_redox_3 Lycopene_cycl Flavodoxin_4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AXG98813
UniProt: A0A345IGJ1
LinkDB All DBs
Position
complement(1252005..1253600)
Genome map
AA seq 531 aa AA seqDB search
MTQGSAVDPRPAQLRAALASPEWDIIVVGGGASGLGSAVEAATRGHRVLLLEGHDYAKGT
SSRSTKLVHGGVRYLAQGNVSLVREALHERGLLRKNAPHLVRDLGFVVPAYDWWAAPFYG
IGLKMYDVLAGKLNLGSSTYLNRDKVLSRVSTYQPKGLKGGILYFDGQFDDARLAITLLR
TLEDFGGVALNYAPVTGLLKDGEQVRGVRFRDEESGQEHEVRAKIVVNATGVWVDDIRRM
EDPSVKPMLSPSQGVHVVVEKKFLPGDSAIMIPRTDDGRVLFAVPWHDHVVIGTTDTPVP
QTDFEPRALEEEVEFILRTAGRYMNPAPTRADVLSVYAGLRPLVKNEKTDGAGSTASLSR
DHVIRISKGNLITLTGGKWTTYRRMGEDTINRAEKLGGLPERLTITPGLHLHGWSEDERP
DHWKVYGNDAERVQQLPGADVTLHPALPYTEAELRWAVRHESARTVEDLLSRRTRALLLG
ARASMEAAPRAAAILAEELGGAGAGKDAAWQAQQVEAFRQIASGYVLSSGA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaggttctgctgtcgatccccgtccggcccagctgcgggcggccctcgcgtcc
ccggagtgggacatcatcgtggtgggcggcggcgcgtccgggctgggcagcgcggtggag
gccgccacccgtggccaccgcgtgctgctgctcgaaggccacgactacgccaagggcacc
agcagccgctcgaccaagctggtacacggcggcgtgcgttacctcgcccagggcaacgtg
tcgctggtgcgcgaggcgctgcacgagcgcggcctgctgcgcaaaaacgcccctcacctc
gtgcgtgacctgggcttcgtggtcccggcctacgactggtgggccgcgcccttctacggc
atcggcctgaagatgtacgacgtgctggcgggcaagctcaacctcggcagctcgacgtac
ctcaaccgcgacaaggtgctgtcccgcgtgtccacctaccagcccaagggtctgaagggc
ggcatcctgtacttcgacgggcagttcgacgacgcccgcctcgccatcaccctgctgcgg
accctggaggacttcggcggcgtggccctgaactatgccccggtcaccgggctgctcaag
gacggcgagcaggtgcgcggcgtgcgcttccgcgacgaggaaagcggccaggaacacgag
gtccgcgccaaaatcgtggtgaacgcgaccggcgtgtgggtggacgatatccgccgcatg
gaagaccccagcgtgaagcccatgctctcgcccagccagggcgtgcatgtcgtggtcgag
aagaaattcctgcccggcgacagcgccatcatgattccccgcaccgacgacgggcgcgtg
ctgttcgccgtgccctggcacgaccatgtggtcatcggcaccaccgacaccccggtgccg
cagaccgactttgagccccgggcgctggaagaggaagtcgagttcatcctgcgcaccgcc
gggcgctacatgaacccggccccgacgcgcgccgacgtgctgagcgtgtacgcggggctg
cgtccgctggtcaagaacgagaagaccgacggcgccgggtccaccgcgtccctctcgcgt
gaccacgtgattcgcatttcgaagggcaacctcatcaccctgaccggcggcaagtggacc
acctaccgccgcatgggtgaagacaccatcaaccgcgccgagaagctgggcggcctgccg
gagcgcctcaccatcacccccggtctgcacctgcacggctggagcgaggacgagcgaccc
gaccactggaaggtctacggcaacgacgccgagcgcgtgcagcagcttcccggcgccgac
gtgacgctgcatcccgcgctgccctacaccgaggccgaactgcgctgggccgtgcgccat
gagagtgcgcgcaccgtcgaggacctgctctcgcgccgcacccgcgccctgctgctcggc
gcccgcgccagcatggaggccgccccccgcgccgccgcgattctggccgaggaactcggc
ggcgcaggggcaggcaaggacgccgcgtggcaggcccagcaggtcgaggccttccggcag
attgccagcggctacgtgctgtcgtccggcgcctga

DBGET integrated database retrieval system