KEGG   Drosophila yakuba: Dyak_GE10340
Entry
Dyak_GE10340      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
Organism
dya  Drosophila yakuba
SSDB
Motif
Pfam: Protamine_like DUF5686
Other DBs
NCBI-GeneID: 6537820
NCBI-ProteinID: XP_002098361
FlyBase: FBpp0255350 FBgn0228208
UniProt: B4PMG8
LinkDB
Position
3R
AA seq 187 aa
MGHAISRSVENRESIVAYRNFLKLYRNQHRQMPSNDAFLNAARVWGTFSPAQRNRYAHMG
SATKIIMGAPKRVAPKKAKKITKKVVARKKVVKKNPKAKGVPQRRARDNVTAYKPLIRSR
TPVSGAKRISNNEVVRESLLPSNGFLNFMEFYHEIHRDMPKSLAVKEAVSAWSDMNMEQR
GIFNMDL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggtcacgccataagtagatcagtcgagaacagagagtccatcgtcgcctacagaaac
ttcctgaaactctacagaaatcagcacaggcagatgccctccaatgatgcatttttgaat
gcggctcgtgtttggggaactttctcgccggctcagcggaatcgatatgctcatatgggt
tccgcaaccaagatcataatgggtgcgcccaagcgggtggctcccaagaaggccaaaaag
attacgaagaaagtggttgctcgtaaaaaggtggttaaaaagaatcccaaggcgaaggga
gttcctcagcgacgagctcgcgataatgtcactgcttataaaccgctaatacgcagcagg
actcccgtctcaggagctaaaaggatctcgaacaatgaggtggttagagaaagtttgcta
ccctcgaatggctttctaaacttcatggagttctaccatgagatccatcgcgatatgccg
aaatccttggcggtgaaagaggctgttagtgcctggagcgatatgaacatggagcagcgt
ggcattttcaacatggacttgtag

DBGET integrated database retrieval system