KEGG   Drosophila yakuba: Dyak_GE12354Help
Entry
Dyak_GE12354      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dya  Drosophila yakuba
Pathway
dya04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dyak_GE12354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dya01002]
    Dyak_GE12354
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dya04147]
    Dyak_GE12354
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dyak_GE12354
Peptidases [BR:dya01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dyak_GE12354
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE12354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6530298
NCBI-ProteinID: XP_002091225
FlyBase: FBpp0257364 FBgn0230102
UniProt: B4P6I5
LinkDB All DBs
Position
2R
AA seq 256 aa AA seqDB search
MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGTTTTISSFPWQISLQRSGSHSCGGSI
YSSNIIVTAAHCLQSVSTSVLQVRAGSSYWSSGGVTVSVAAFKNHEGYNANTMVNDIAII
KLSSALSFSSTIKAISLASSNPANGAAASVSGWGTQSYGSSSIPSQLQYVNVNIVSQSNC
ASSTYGYGSQIKNTMICAYSSGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYANYPGVYA
DVAALRSWVISAANSV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttcgtgatcttgttgtctgcagtagcctgcgccctgggaggcaccgtcccc
gagggactcctgccccagttggatggccgcattgtcggaggtactactaccaccatcagc
agcttcccctggcagatctccctgcagcgcagtggaagccactcctgcggtggatccatc
tactccagcaacatcattgtgaccgccgctcactgcctgcagtccgtgtccacttccgtc
ctgcaggtccgtgctggatctagctactggagctccggtggtgttaccgtatctgtggcc
gccttcaagaaccatgaaggttacaacgccaacaccatggtcaacgacattgccatcatc
aagctcagcagtgccctgagcttcagctccaccatcaaggccatctctctggctagctcc
aaccccgccaacggcgctgctgcctccgtctccggatggggtactcagtcctacggatcc
agctccatcccctcccagctccagtacgtgaacgtgaacatcgtcagccagagcaattgt
gcttcctccacctacggatacggtagccagatcaagaacaccatgatctgcgcttattcc
agcggcaaggatgcctgccagggtgactccggtggcccactggtctccggcggagtcctc
gtcggtgttgtctcctggggttacggatgcgcttacgccaactaccccggtgtctacgcc
gatgtggctgccctccgctcctgggtgatcagcgctgctaacagcgtctaa

DBGET integrated database retrieval system