KEGG   Drosophila yakuba: Dyak_GE12374
Entry
Dyak_GE12374      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K20017  Bcl-2 family protein
Organism
dya  Drosophila yakuba
Pathway
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE12374
   04215 Apoptosis - multiple species
    Dyak_GE12374
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6530247
NCBI-ProteinID: XP_002091184
FlyBase: FBpp0353893 FBgn0230120
UniProt: B4P621
LinkDB
Position
2R
AA seq 298 aa
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRR
RLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRVYTGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTTNSLNPLEWTTLVIGVVFGLILVFMILRFIFNAIVPKIYQRFTN
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataatgataatttcagcaacggatttccgatggcc
accacacaaagtgagcgcctgctgcaggcacagaatcgcagaaagttcagttttccagcc
acactccattccgcctcacttttggaggtgggtggtgggcccaaggagaccacgagacgg
aggttgagcaatgtcagcgatgccgtcaccaggaaactctcctatacgattggctggaag
gcggcacagattccggcgcaggatatcatatctcagggtcgttgcctgtgcggtcattac
atcaagagacgtctgagaagatccggtttgttcaataaaaagctgggactgcagcgcata
cgtagcatactgggctccacctccatgggcattgtgcgagatgtgtttccagcggtccaa
gtgctgggcgatgaactggagcgcatgcatcccagagtttacaccggagtagcgcgtcag
atttgccggaatccgggtggtgagttccatactccggatgcagtgagcttgcttttgggc
gccgtgggccgggagctctttcgggtggagatcacctggagcaaggtgatctcattgttt
gccatcgccggcgggctgtccgttgactgtgtacgtcaaggacatccggaatacctgccc
aagttgatggagagcgtttcggaggtgatcgaagatgagctggtaccgtggattaacgag
aacggtggctggagcggcatcaacacacatgttttacccacaaccaacagcctgaatcct
ttagagtggaccactttggtcataggcgtagtgtttggcctgattctagtttttatgatt
ctgcgatttatatttaacgcgattgtaccaaaaatataccaacggtttacgaattga

DBGET integrated database retrieval system