KEGG   Drosophila yakuba: Dyak_GE12923
Entry
Dyak_GE12923      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dya  Drosophila yakuba
Pathway
dya00230  Purine metabolism
dya01100  Metabolic pathways
dya04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dyak_GE12923
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dyak_GE12923
Enzymes [BR:dya01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Dyak_GE12923
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 6529205
NCBI-ProteinID: XP_002090212
FlyBase: FBpp0257933 FBgn0230637
UniProt: B4P6G7
LinkDB
Position
2R
AA seq 1167 aa
MEANLENGQMTTASTSKSHSLRQATSRRRQNDSEVAGGVGITGGGVVILPQHVLNELYHN
YSLKQRRSGLKWFVFAAVLFNIWTIGIPWDQAAPTRVVNCCMLVAYLALISLLHIGRRSD
RPALRRFHHILLIIVPRALWLLSIVHFTVYVILQPSFSPRDLLGWAILLNFLVYVTLPLQ
LIFLGLSIGCITYFICLSLPLGYSHWDSLLSNQLAANAILIATAALIGLLYYFMGEAKQK
RAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHE
NVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGA
PDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYS
KDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGLKTYFITKVV
KAFASPCAKKINETQDQISHPSTNESTNDIISDEDDNVATMDHEELLAQNSLSNGHQIVT
TLTADEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQLYAVYREPYSS
LPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVVISLAESFSGMLPKFFVD
VSKRFNDITFVRELAAIIIALTIGFSNVIDMFFFVTFVRTEHIVSESEFNVTASQDRDIN
VEMEGIITAEHLLPASFVEQMRDAVPPERVLYPSYLSNFGVLILIAIAVIAQLTHLTKIL
LLLSIAALHCYFNIFIMQDLYALEDDFENQPIISTRYAASGLLLVAALALSTLARHMDHE
DRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEV
GVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYM
AASGINQQRTLRNDAPITERWSHLAILVEFALELKHALHGINEQSFNHFVLKMGINHGPI
TAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEDTCNILQPFGYKFLQRGLVAVK
GKGQLMTFYLQGKSQTSAEPVPPGAVQLNGQDSFAPESTSELEVSDIKMPLLKMNVPEQS
VGINQDQSFRKDSDGQERLGEFQSLLE
NT seq 3504 nt   +upstreamnt  +downstreamnt
atggaagcaaatttggagaacggtcagatgacgaccgcctcgacaagcaaatcgcactcc
ttgcgtcaggcaacatcccgtcggcggcaaaacgacagtgaggtggccggaggagtggga
atcaccggtggcggagtcgtcattttgccgcagcacgtgctcaacgaactctaccacaac
tactccctcaaacaacgccgcagtggattgaagtggtttgtctttgccgccgtgttgttt
aacatatggaccatcgggataccctgggatcaggcggcacctacgagagtggtcaactgt
tgtatgctggttgcttacttggcattgatatcgctccttcacattggacgacgttctgat
cgaccggcactaaggcgcttccaccacatactcctgattattgtaccacgggcactgtgg
ctattaagcattgtacattttaccgtctatgttattctgcaacctagtttttctccaagg
gaccttcttggctgggccatccttttaaacttcttggtttatgtgacgctgccattacag
ctgattttccttggtctgtcgattggatgtatcacatattttatttgtcttagtctgcct
cttggttattctcactgggactcgctgctctcaaaccagttagcggctaatgcgatttta
atagccacggcagcgctgataggccttttgtactactttatgggtgaggcgaaacagaaa
cgagccttcctcgaagccaaaaagagccttgaagtaaaaatggtcatagaggaacagtcg
gccgagcaggagcgcctgctcttatctgtgctgcccaagcacgtggctatcaagatgcga
gaagatttgggatcatccagttccgaggcttttaaaaaaatctacatgagtcggcacgag
aatgtaagcattctatatgcggatattgttggttttaccgccatctcctccacgtatagt
gcccaagatttggtaaaaatgcttaacgagctctttgctcgtttcgataggcttgccgag
aaatatcaacaattgcgcattaagattcttggtgattgctattattgcattagcggtgcc
cctgatgagcgtccagatcacgccgtcatgtgcgtgcacatgggactctccatggtgaag
gccattaagtatgtgcagcagaaggccaactcacctgttgatatgcgagtgggcattcac
actggagccgttcttgccggtattctcggccagcggcagtggcagtttgacgtttactca
aaggacgtagagctggctaataaaatggaatcgagcggaaaggcaggtcgcgttcacatt
tcggacaaaacgcttgcatttctaaacggcgagttcgaagtagaacccgcctttggggag
aaacgggaggagctgttgcgtattgctggattaaagacgtattttattaccaaagtagtt
aaggcgtttgcatctccatgtgccaaaaaaataaatgaaacccaggaccaaatctcacac
cccagtactaatgaatcgacaaacgatattatatcagatgaagatgacaacgttgccaca
atggaccacgaagagctcctggcgcagaattctttatccaatggacaccaaatagtgact
acactgactgcagatgaagaggagcaggtaaaattggagaacttcaaacaacgattgaaa
gatgaactggtaactcgcgacggacatgaaaacctaaccaaggacactaacatatttttg
cgctttaaaaacccgcaactggagcaattgtatgccgtatatagagaaccgtatagttca
cttccgcttcttgccgctcttctggtgcagtgcattgatgtgttatactcatacttggtt
ctgccgagatctactctccactttatcaacatagcagcgccgttggtaccgatcgccatg
ctggtagtgatcagccttgcagagagctttagcggcatgctgcccaagttttttgtagac
gtgagcaagcgcttcaatgacataacctttgttcgcgagctggccgccataattattgca
ctcacaattggcttcagtaacgttatcgacatgttctttttcgtcactttcgtgcgtacc
gagcatattgtgagtgaaagcgagtttaatgtaacggccagccaagatagagatataaac
gtggagatggaggggattatcacagcagagcacttacttcctgcatcgtttgtggaacaa
atgcgcgacgctgtgcccccggaacgagttctatatccgtcctacttaagtaactttgga
gtacttatattaattgcgatcgccgtgattgcccaacttactcatcttacaaagattttg
ctgctattgtccattgcagctttgcattgctatttcaatatattcatcatgcaggatctt
tatgctctagaggatgatttcgaaaatcaacctattatatctacgcgatatgccgcttca
ggacttctgctagtggctgctctggcgttaagcaccttggcaagacacatggaccatgag
gatagggtaattttcaaatggaaaaccgaggtcgccgagcaaaaggagactgcaaacgac
atgcggcagcgaaacgaggctttggtctacaatgtcttacccgtccatgtggcagagcac
ttcatgaagaacacaaaacgctctcatgatgatctttattcccagagctatgctgaggtg
ggcgtattattcgccagcatgccaaacttttctgatttctattccgaagaaacagtaaac
aaccagggtttggagtgtttacgttttctcaatgaggttatctcagattttgatgctttg
ttagagctgccccaattccaagacatcatcaaaataaaaactattggttccacatatatg
gctgcaagtgggataaatcagcagaggactctcagaaatgacgcccccattacagaaagg
tggtctcacctagcgattttggtagagtttgcattggaactgaaacacgccttgcatggc
atcaacgagcagtcgttcaatcacttcgttctcaagatggggatcaatcatggaccgatc
acggctggcgttattggcgcacgtaaacctcattacgacatctggggtaatacagtgaat
gtggcatcgcgaatggagagcacaggaaaggcgggcgccattcaggtcacagaggatacc
tgcaatattttacagccctttggttacaaattccttcagcgtggtctggtagctgtcaaa
ggaaagggacagttgatgacattttatctgcagggtaagtcccagacgagtgctgaaccg
gtgcccccgggcgcagttcagcttaatgggcaagattcttttgctccagaatccacaagt
gaactggaggtctcagacattaagatgcccctgctgaagatgaatgtgccagagcaatcg
gtgggaatcaaccaagatcagagcttcagaaaggacagtgatggccaagagaggctgggg
gaatttcagtctttgctagaataa

DBGET integrated database retrieval system