KEGG   Drosophila yakuba: Dyak_GE13119
Entry
Dyak_GE13119      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
Organism
dya  Drosophila yakuba
SSDB
Motif
Pfam: Flu_B_M2
Other DBs
NCBI-GeneID: 6529440
NCBI-ProteinID: XP_002090444
FlyBase: FBpp0258129 FBgn0230818
UniProt: B4P8P8
LinkDB
Position
2R
AA seq 146 aa
MPDKRPLDPLQPVLYIDHCRYRPTYRKRALHLHSSLAEALKAIQPRVKLQLRINDKGPPQ
DGSFEVAVSPQPTDDAKARQSVWTGLRRMPSASKVPHVDDILTPVCFALQLRDPHKESHR
RMLTNLRHNEGSRARRRDIKNVSNNT
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcccgacaaaaggccactggatccactgcagccggtgctctacattgaccactgccgc
tatcgtccaacctatcgcaaacgggccctgcacctccattcttcgctggcagaggctctg
aaggccattcagccaagggttaagctccagctaaggatcaacgacaagggaccgccgcaa
gatggatcctttgaggttgctgtttccccgcaaccaaccgatgacgccaaggcccgccaa
agtgtatggactgggctgaggcggatgcccagtgcatcgaaggttccccatgtggacgac
attctaaccccagtttgtttcgccctccaactgagggatccgcacaaggaatcacatcgc
cggatgctgaccaatttgcggcacaacgagggcagtcgagccaggaggagggatatcaaa
aatgtgtcaaataatacttag

DBGET integrated database retrieval system