KEGG   Drosophila yakuba: Dyak_GE13162Help
Entry
Dyak_GE13162      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00078  dihydrodiol dehydrogenase / D-xylose 1-dehydrogenase (NADP) [EC:1.3.1.20 1.1.1.179]
Organism
dya  Drosophila yakuba
Pathway
dya00040  Pentose and glucuronate interconversions
dya00980  Metabolism of xenobiotics by cytochrome P450
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE13162
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE13162
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.179  D-xylose 1-dehydrogenase (NADP+)
     Dyak_GE13162
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.20  trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
     Dyak_GE13162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 6529508
NCBI-ProteinID: XP_002090510
FlyBase: FBpp0258172 FBgn0230857
UniProt: B4P993
LinkDB All DBs
Position
2R
AA seq 472 aa AA seqDB search
MFKLITYFKSRPKKFGVRCYQNHLPTGRATRSASRSDGRRGRFGFVGCDIGDHNMWRPRP
RQLHINRFPSSKADSKATLERGDWVVDERPTLRWGIAPVSLMADDFAAALSVLPEQHHRI
VSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDK
HVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEIQKVH
CTLGLPVSQGRLGLYGGVTNDFGVYGMQLALWVFREVPRCLKVSGRVNSEHVDVSADIEL
CFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEFPLPGGDQMP
PTHYHNRLGMCYEAEEVRNCILKGSMESDDFSHNESLLLANLMDTIHAELGVGEFASRSE
VSDLQRQIENVQDIVDDPEELASETCRVVEDVSMGGSLEISQQGEKDQVKGH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagctaataacatatttcaagtcgcgaccgaaaaaatttggcgtgagatgctat
caaaatcacctgcccacaggtcgtgccacacgttcagcaagcaggtcggatggcaggcgt
ggcagatttggattcgttggctgcgatattggtgaccacaacatgtggcgaccccgacca
cgccagctgcacatcaatcggttcccctcctccaaggccgactcaaaggcgaccctcgaa
aggggcgattgggtggtggacgagaggccaacgctgcgctggggcatcgcacccgtcagc
ctcatggcggatgactttgccgcggcgctgagtgtcctgcccgagcagcaccaccgcatt
gtgtcctgcgtggctgcgtatcagtcgcacgccctcgccttcgccgaacgccatcaggtg
gagaacgtgtacaccagcttcgaggatctggccaagtgtccgaatgtcgatgtagtgtac
atctcccccctaaatccccaacactcggagctgtgccatctcatgttgaaccacgacaag
cacgtcctgtgtgaaaagccgctctgcatgacggaggagcaggtgaccaagctgctggag
aaggcgcgggcgcgcggtctgtttctcatggagggaatgtggccaagatgcgtgcccgcc
tatcattacctgcggcatcagatcctgcgaaaccgtctaggagagatacagaaggtacat
tgcactttagggctgcccgtttcgcaggggagactaggactgtacggcggggtaaccaac
gatttcggggtatacggtatgcagctggctctgtgggtgtttcgagaagttccacgctgc
ctcaaggtcagcggtagggtcaactcggagcacgtggacgtgtccgccgacattgaactg
tgcttcacgcgtggaaagagggctctcatcgaggtcagctccgaaaagaagctcagcaac
caggcagttattcaaggcaaggatgggtccattaagatgaacaactactggtgtcccact
cgcctgatcaccgaggaggtggactacgagttccccctcccgggtggcgatcagatgcca
cccacccactaccacaatcggttgggcatgtgctacgaggccgaggaagtgcggaactgc
attctgaaaggcagcatggagagcgatgacttcagtcacaacgagagcctgctgctggcc
aatctaatggacaccatccacgccgaactgggagtcggtgaattcgctagtcgcagcgag
gtttcagatctgcagaggcagatcgagaatgttcaagacatagtcgatgatccggaggag
ctggctagcgagacgtgccgggtagtggaggatgtcagcatgggcggaagcttggaaatc
agtcagcagggagagaaagaccaggtcaaaggtcattga

DBGET integrated database retrieval system