KEGG   Drosophila yakuba: Dyak_GE13847Help
Entry
Dyak_GE13847      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
dya  Drosophila yakuba
Brite
KEGG Orthology (KO) [BR:dya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dya01001]
    Dyak_GE13847
   01009 Protein phosphatases and associated proteins [BR:dya01009]
    Dyak_GE13847
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     Dyak_GE13847
Protein kinases [BR:dya01001]
 Non-receptor tyrosine kinases
  FAK family
   Dyak_GE13847
Protein phosphatases and associated proteins [BR:dya01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dyak_GE13847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_M Haspin_kinase FERM_F2 Kinase-like GIT1_C
Motif
Other DBs
NCBI-GeneID: 6530945
NCBI-ProteinID: XP_002091786
FlyBase: FBpp0258857 FBgn0231493
UniProt: B4PB85
LinkDB All DBs
Position
2R
AA seq 1200 aa AA seqDB search
MNTAGATSQPPPTKNETHSEEYLIHVHMPNKSFKAVRFNVKETVFHVIRRTVEDLGTDGR
TPSIQRYACRMLNMITKEVIWLARSTSMQKVLSHILTPGCSNVDCPNNQAELDEVLLEHG
RRITDNRVWRVELRVRYVPNNIQELFEEDKATCFYYFNQVKEDFIQANVTSIDTEVAVQL
CCLGIRHYFKNITVKAPDKKQHIDYIEKEIGFKSFLPQSVIATSKPKNLKKLIQVGYKKV
YNYNDIEYLTRFFDLLKNIYLTNFEQFAVTLSSAWNISGILHVGPHIGISYQTHPQASLT
NVAQFKDVVSIKTCTLPKEKLSKSGENTTEPELQNFNCNCQKIKTQIKISASNNVEDLVI
TCNGINTAESIADLIDGYCRLLSKDLEFTIWHRETTASNEDSAKALPNDATLGSNKSTSS
QGKPMLTDDYAEIGLLEGEGDYSTPTVRNYELDRALITPSAKIGVGQFGDVYVGTYTLPK
LGKGKNAAGNGKNSNSDQRNADARPDVIQVAIKTCKANDDPEKTENFLAEAYIMQKFDHP
HIIRLIGICSVMPIWIVMELAKLGELRAYLKTNSERLSHGTLLKYCYQLSTALSYLESKK
FVHRDIAARNVLVSSPTCVKLADFGLSRWVSDQSYYHSTPTVALPIKWMSPESINFRRFT
TASDVWMFGVCIWEILMLGVKPFQGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQCWA
YEPLKRPNFKRIKETLHEILIEDSINSSETLKREQRKVASMSWIGSDDIDIPPSKPSRVI
HDPDITGLMPETTGLPQTYIIAQNPAVLAKLMMENQKRGINPAAYTTPASGIHNVLGEKL
RQQQKDSNSDSEWLIQEELLRQRSCSIPQGSINDHQAQIFKLDFMSAGPSSLPDCSNSSS
RPMTPNANLSSLKSNHSSADHLSSLTAAEEQMGPNARNLGSAVSSRPLNRADDEVYCATT
LVVKSIMALSQGVEKANTEGYLELVKNVGVKLRNLLTSVDKISVIFPAQALKEVQMAHQV
LSKDMHELVSAMRLAQQYSDTTLDCEYRKSMLSAAHVLAMDAKNLFDVVDSIRQRYQHLF
PPSATKETNCSSSFESTSGSIVTEPVNDLGGYIKTSTSGDLLQNTGIYDNDLHHSFNSQL
QLQNPKASIDLSGGGSLQRGMSLGLDTTRSTNEPLRIVEETLGSPGEHMYCNTSALHGHA
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgcgggagccaccagtcaaccgccgcccaccaaaaatgagacacactccgag
gagtatctcatccatgtgcatatgccgaacaagagctttaaggctgttcgttttaatgtc
aaggagaccgttttccatgtgatccgacgcaccgtcgaggatctgggcacggatggacgg
acgccaagcatccagcgttatgcctgccgaatgctcaacatgatcaccaaggaggtgatc
tggctggcaaggagcacttcgatgcagaaggtcctgtcgcacatcctgacgcccggttgc
tccaacgtcgactgtcccaacaatcaggcggagttggatgaggttctgctggagcacggc
cgaaggatcaccgacaacagggtgtggcgagtggagcttagagtgcgctacgtgccaaat
aatattcaggagctctttgaggaggacaaggccacatgcttctattacttcaatcaggtg
aaagaggactttattcaagccaatgtcacatccatcgacacggaagtggcggtgcaactg
tgctgtctgggtattcgtcattattttaagaacataacagtgaaagcacctgacaagaag
cagcacattgactacattgaaaaggaaatcggatttaaaagttttcttcctcaatctgtg
atagccacatcaaagccaaagaatcttaagaaactgatccaagtcggttacaaaaaggtc
tacaattacaatgacattgagtacttgacgcggttctttgatcttctgaagaatatttat
ttaacgaactttgagcagttcgcggtaaccctgagctcggcgtggaatatttctggaatt
ctacacgtcggtcctcacattggaatctcttaccagactcatcctcaggccagcttgacg
aacgtggctcagtttaaagatgtggtctccattaaaacgtgcactttaccaaaggaaaaa
ctgtccaagtctggcgaaaataccacagaaccagagcttcagaactttaattgcaactgc
cagaagattaaaacccagatcaaaatatcagcatcaaacaatgtggaagatttggttata
acatgcaatggtattaataccgctgagagtattgctgacctcattgacggttactgcagg
ctgttatcaaaagacctagagttcacaatttggcatcgagagacaaccgcgtcgaacgaa
gatagcgcaaaagcattgcccaatgatgcgacgctggggtctaataaatcaacttcaagt
cagggaaaaccgatgctgaccgatgattatgccgagattggattattggaaggcgagggc
gactactctacgcccaccgttcggaattatgagttggacagagccctcattacgccgagc
gctaaaattggtgtgggtcagtttggtgatgtctatgtaggcacatatacgcttccgaaa
ttgggcaagggaaagaacgctgcaggaaatgggaaaaatagcaatagtgaccaaagaaat
gccgatgcaaggccagacgttattcaagtggcaataaagacatgtaaagctaacgatgat
cccgaaaaaacagaaaactttcttgccgaagcttatattatgcaaaaattcgatcatccg
catattattcgcctaattggcatttgcagcgtaatgcccatttggatagtcatggaattg
gccaaattgggtgaactgcgtgcctacttgaagacaaacagcgaaagattaagtcacggc
acgctactgaagtactgctatcagttatcaactgctctcagttatttggaatccaagaag
tttgttcaccgagatattgcggcgcgtaatgtacttgtcagctcaccaacgtgtgttaag
ttggctgactttggattatcacgttgggtttccgatcagtcgtattatcactcaacaccc
acagttgctcttcccatcaaatggatgtcgcccgagtcaataaattttagaagatttacc
actgctagtgatgtttggatgtttggtgtctgtatttgggaaatactcatgctgggtgtt
aagcctttccaaggcgtcaagaacagcgatgttatattaaagctcgaaaacggagagcgc
ctgccattgccgcccaactgcccgcctagattatattcgttaatgtcccaatgctgggca
tacgaacctctcaaacgaccaaatttcaagaggatcaaggaaactctacatgaaattctt
attgaagacagcattaattcatcggagacactgaagcgggagcaacgaaaagtggcttcc
atgtcctggattggcagtgatgacatcgacattccgccatcaaaaccttcaagggtgatc
cacgatcccgacattactggtttaatgcctgaaacaacggggctacctcagacttatatt
attgcgcaaaatcccgcggtgctggccaagctgatgatggagaaccagaaacgaggcata
aacccagcggcgtacaccacaccagcttcgggcattcacaatgttttgggcgaaaaacta
agacaacagcaaaaagatagtaacagcgacagcgaatggttaattcaagaagaattgctg
aggcagagatcctgctcaatacctcaaggatcgatcaatgatcaccaggcacagattttt
aagcttgacttcatgtcagccggtccttctagtttaccggactgctcgaactccagttcc
cgaccgatgacgccaaatgctaatctctcttcgctgaagtcgaaccactcatcggcggat
catttgtccagcttgacggctgcagaagaacagatgggtccaaatgcacgaaacttaggc
agtgctgtttcaagtcgcccactgaaccgcgcagatgatgaagtttattgcgccaccaca
ctggtggtcaaatcaataatggcgctgtcacaaggtgtcgagaaagccaataccgagggt
tatttggaactggttaagaatgtgggcgtcaagttgagaaacttgctcacatcggtggac
aaaatatctgtcatttttccagcacaggcccttaaggaagtgcaaatggcacatcaggta
ctttcaaaagacatgcatgaattggtctcagcgatgcgattggcccagcaatatagcgac
actacgctggattgtgaatatcgcaagagtatgctgtctgctgcccacgtattggctatg
gacgccaaaaacctgtttgatgtcgtcgattcgatacgtcaacgttatcagcatctattc
ccgccatccgccacaaaagaaactaattgttcgtcaagttttgagtcaacttctggctct
attgtcacagagccggttaatgaccttggtggatatatcaagacgagcacatcgggagat
ttgcttcaaaacacaggaatttatgataatgatctgcatcatagtttcaactcgcaattg
caattgcaaaacccaaaagccagcatcgacttgagcggcggtggtagtctgcagagagga
atgagtcttggcttggacaccaccaggtcgacaaatgaacccttgcgaattgttgaggag
accctcggcagtccgggggaacatatgtactgcaatacgtccgccttgcacggccacgcg
taa

DBGET integrated database retrieval system