KEGG   Drosophila yakuba: Dyak_GE13850Help
Entry
Dyak_GE13850      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dya  Drosophila yakuba
Pathway
dya00020  Citrate cycle (TCA cycle)
dya00190  Oxidative phosphorylation
dya01100  Metabolic pathways
dya01200  Carbon metabolism
Module
dya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dya_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dyak_GE13850
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dyak_GE13850
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dyak_GE13850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like TBK1_CCD1
Motif
Other DBs
NCBI-GeneID: 6530952
NCBI-ProteinID: XP_002091790
FlyBase: FBpp0258860 FBgn0231496
UniProt: B4PBL8
LinkDB All DBs
Position
2R
AA seq 661 aa AA seqDB search
MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD
AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPEKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT
IDKDGKDVIVPGLYAAGESASSSVHGANRLGANSLLDLVVFGRACAKTIAELNRPGAPAP
TLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEI
YKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAHAREDFKVRED
EYDFSKPLEGQQKKPMDKHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNEVSTVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaatcatgcgtgtgccatcgattttggccaaaaatgcagtcgcctccatgcaa
cgtgccgcagccgttggagtgcagcgcagctatcacatcacacacggccgccagcaggcc
tcggcggcgaatccggataagatatcgaagcagtacccggtggtggatcacgcctacgat
gcgatcgttgtgggagctggaggagccggcttgcgggctgcttttggcctggtggctgag
ggattccgcacggcggtgatcaccaaattgtttcccacccgctcgcacacgatcgccgct
cagggcggcatcaatgcggctttgggcaacatggaggaagatgactggaagtggcacatg
tacgacacggtcaagggctccgattggctgggcgaccaggatgccatccactacatgacg
cgcgaggcgcccaaggctgtcattgagcttgagaactacggcatgcccttctcgcgtacc
caggacggcaagatctaccagcgcgccttcggtggacagagtctgaagttcggcaagggc
ggacaggcccatcgctgttgtgctgtggctgatcgtactggtcactcgctgctgcacacg
ctctacggacaatccctgagctacgactgcaactacttcgtggagtactttgccctggat
ctgatcttcgaggatggcgagtgccgtggtgtgctggccctgaacctggaggatggcaca
ctgcaccgattccgcgctaagaacacggtcattgccaccggcggatatggacgcgccttc
ttctcctgcacctcggcgcacacatgtaccggtgacggtaccgccatggttgcccgacag
ggactgccctctcaggatttggaattcgtgcagttccatcctactggaatctacggcgcc
ggctgtctcatcaccgagggctgccgcggtgagggtggttacctgatcaacggtaatggc
gagcgcttcatggagcgctatgctcctgtggccaaggatctggcctcccgcgacgtcgtc
tcgcgttcgatgaccattgagatcatggagggtcgtggcgctggacccgagaaggatcac
gtgtacctgcaattgcaccacttgccgcccaagcagctcgccgagcgactgcctggcatc
tccgagaccgccatgatctttgccggtgttgatgtgacccgcgagcccatccccgtgttg
cccaccgtgcactacaacatgggcggtgtgccaaccaactaccgcggccaagttatcacc
attgacaaggatggcaaggatgtgattgttccgggactgtatgctgctggtgagtctgct
tccagctcggtgcatggcgccaaccgtctgggtgccaactctctgctggatctggtggtc
ttcggacgtgcatgcgccaagactatcgccgaactgaataggcctggtgcacctgctccc
accctcaaggaaaacgctggcgaggcctctgtggccaacctggataagctgcgccatgcc
aacggccagatcaccaccgccgatctgcgtctgaagatgcagaagaccatgcagcatcat
gctgctgtgttccgcgatggtcccatcctccaggacggtgtgaacaagatgaaggagatc
tacaagcagttcaaggacatcaaggtcgttgataggtcgcttatctggaactctgatctg
gtggagacgctggagctgcagaacttgttggccaatgcccagatgactattgtgagcgct
gaggcgcgcaaggaatcgcgaggtgcccatgcccgtgaggacttcaaggttcgcgaggat
gaatacgatttcagcaagccccttgaaggccagcagaagaagcccatggataagcactgg
cgcaagcacacgctgtcgtgggtgtgcaatgacaacggagacataacgctggactacaga
aacgtgatcgataccacgctggacaacgaagtctctactgttccaccagcgattcgctcc
tattaa

DBGET integrated database retrieval system