KEGG   Drosophila yakuba: Dyak_GE14387
Entry
Dyak_GE14387      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11131  H/ACA ribonucleoprotein complex subunit 4 [EC:5.4.99.-]
Organism
dya  Drosophila yakuba
Pathway
dya03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dya00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    Dyak_GE14387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dya03009]
    Dyak_GE14387
   03032 DNA replication proteins [BR:dya03032]
    Dyak_GE14387
Enzymes [BR:dya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.-  
     Dyak_GE14387
Ribosome biogenesis [BR:dya03009]
 Eukaryotic type
  Sno RNPs
   Box H/ACA snoRNPs
    Dyak_GE14387
 Prokaryotic type
    Dyak_GE14387
DNA replication proteins [BR:dya03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     Dyak_GE14387
SSDB
Motif
Pfam: DKCLD TruB_N TruB_C_2 PUA UPF0113
Other DBs
NCBI-GeneID: 6532002
NCBI-ProteinID: XP_002092788
FlyBase: FBpp0259397 FBgn0231995
UniProt: B4PAW0
LinkDB
Position
2R
AA seq 508 aa
MADVEVRKEKKKKKIKEEPLDGDDIGTLQKQGNFQIKPSSKIAELDTSQWPLLLKNFDKL
NIRSNHYTPLAHGSSPLNRDIKEYMKTGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG
TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHGAVESVAKVRQGLEKLRGALFQ
RPPLISAVKRQLRVRTVYDSKLLDYDENRNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQ
MLELRRVRSGIQSERDGMVTMHDVLDAMWLYENHKDESMLRRVIKPLEGLLVNHKRIIMK
DSSVNAVCYGAKITLPGVLRYEDGIEIDQEIVICTTKGEAICLAIALMTTATMASCDHGV
VAKIKRVIMERDTYPRKWGLGPKASAKKALIAAGKLDKFGRPNENTPKEWLTGYVDYNAK
KPAAQEVTPSNGSSEPSKRKLSTSSVEETAAVAVSDETPSKDKKKKKKKHKGDEEAPEAA
EEEAEPVEKEKKKKKKKDKDREKDEAQE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggccgacgtggaagtacgcaaggagaagaaaaagaagaagatcaaggaggagcccttg
gacggcgatgacattggcacgctgcagaagcagggcaacttccagatcaagccatcctcc
aagatcgccgagctggacacctcgcaatggccgctgctcctgaagaacttcgacaagctg
aacatccgttccaaccactacactccgctggctcacggatcgtcgcccctgaaccgcgac
atcaaggagtacatgaagacgggcttcatcaacctggacaagccctccaaccccagctct
cacgaggtagtggcctggatcaaaaagatcctcaaggttgaaaagacgggccactccggc
actctggatcccaaagtcacgggttgcctgattgtttgcatcgatagggctacccgtctg
gtaaagtcccagcagagcgccggtaaggagtacgtggccatctttaagctgcacggagcc
gtggagtcggtggccaaggtgcgtcaaggcctggagaagctgcgcggtgccctcttccag
cgacctccgctcatctccgccgtaaagcgtcagttgcgcgttcgtactgtctacgacagc
aagctgttggactacgatgaaaaccgcaatatgggtgttttttgggttagttgcgaggcc
ggttcctatatccgtaccatgtgcgtccatttgggtctcgtactgggtgtcggtggccag
atgttggagctccgtcgtgtccgctcgggcattcagtctgagcgcgatggtatggtgacc
atgcacgatgttttggacgccatgtggctgtacgaaaaccacaaggacgagtctatgctg
cgacgtgtgatcaagccgctcgaaggtctgctggtcaaccacaagcgcatcattatgaag
gacagctctgtcaacgccgtttgctatggtgccaagattacattgccaggtgtcctgcgc
tacgaggatggcatcgagatcgatcaggagatcgtcatatgcaccaccaagggcgaggcc
atttgcctggctatcgccctcatgaccacagccaccatggcctcctgtgaccatggtgtg
gtggccaagatcaagcgagtgatcatggagcgcgacacatacccacgcaagtggggattg
ggcccaaaggcgtcggccaagaaggcgctcattgccgccggcaagctagacaagttcgga
aggcccaatgaaaacacaccgaaggagtggctgactggttatgtcgactacaatgccaag
aagccagcagctcaagaagttaccccctcgaatggctccagtgaacccagcaaacgcaag
ttaagcacctccagcgttgaggaaactgcggcggtcgcggtatccgacgagactccttcc
aaggacaaaaagaagaagaagaagaagcacaagggcgatgaggaggccccagaagctgct
gaggaggaggcagagccagtagagaaggagaagaaaaaaaagaagaagaaggacaaggat
agggagaaagacgaagctcaggaatag

DBGET integrated database retrieval system