KEGG   Drosophila yakuba: Dyak_GE15508
Entry
Dyak_GE15508      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16679  wengen
Organism
dya  Drosophila yakuba
Pathway
dya04013  MAPK signaling pathway - fly
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
dya04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE15508
   04391 Hippo signaling pathway - fly
    Dyak_GE15508
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE15508
   04215 Apoptosis - multiple species
    Dyak_GE15508
SSDB
Motif
Pfam: TNFR_c6 PhoR Comm TMEM154 ESSS
Other DBs
NCBI-GeneID: 6525819
NCBI-ProteinID: XP_002101639
FlyBase: FBpp0360367 FBgn0233084
UniProt: B4PWC9
LinkDB
Position
X
AA seq 256 aa
MMPPRLPGGVHGGVMSSRSTSTSGHHLNTTFHKRRRRRQQHHIAGSHISLSHGSYLALLL
LSTTCSLVATSASSSSASSSSADTGIAPADAPPVSQLSIASSSPCAPQHWWDSQRDRCTP
CTRCQGEMIPLRPCQLHTDTICGSIYDLKIDWVVLAKTEPNWKERRKSSEYEHFEHNAPL
QHLTHEQLQQLHEEAAAAWALDWQTGVLYVAVLTCLVFFSVAACILIHHMRQWRRMERRL
DQGEYTHHPTEFHFPT
NT seq 771 nt   +upstreamnt  +downstreamnt
atgatgccgccaagactgccaggcggcgtccatggtggagtgatgagtagtcggagcacc
agcactagtggccaccacttaaacacaacgtttcacaagcgccgacggaggcgacagcag
caccacatcgctggcagccacatcagcctcagtcacggcagctacctggccctgctcctg
ctctccaccacttgctccttggtggccaccagcgcttcctcttcatccgcgtcatcctcc
tctgcagacacaggcattgcgccagcagatgcgccgccggtcagccagttgtccatcgcc
tccagctcgccctgcgccccacagcattggtgggactcgcagcgggatcgctgcacaccg
tgcacccgctgccagggcgagatgataccgctgcgtccttgccagctgcacacggacacc
atctgcggctccatatacgacctcaagatcgactgggtcgtcctggccaagaccgaaccc
aactggaaggagcgccgaaagtcatccgagtatgagcacttcgagcacaatgccccactg
cagcacctgacccacgagcaactgcagcagctgcacgaggaggccgccgccgcctgggcg
ctcgactggcagactggcgtcctttacgtggccgtgctcacctgcctggtcttcttctcg
gtggccgcctgcatcctcatccaccacatgcgccagtggcgtcgcatggagcgtcgcctg
gaccagggtgagtacacacaccatcccactgagttccactttcccacttag

DBGET integrated database retrieval system