KEGG   Drosophila yakuba: Dyak_GE16165Help
Entry
Dyak_GE16165      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dya  Drosophila yakuba
Brite
KEGG Orthology (KO) [BR:dya00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dya03036]
    Dyak_GE16165
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dyak_GE16165
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dyak_GE16165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RskA
Motif
Other DBs
NCBI-GeneID: 6524588
NCBI-ProteinID: XP_002100445
FlyBase: FBpp0261175 FBgn0233708
UniProt: B4Q232
LinkDB All DBs
Position
X
AA seq 1261 aa AA seqDB search
MSSPDDRIPIHDLPSEAGSDERLLHITPATLTLDFKPHPAVDIDQQIMELKKSQELQKQR
LINSFQEQSKQMELEHKLQLEHKYQFAVNSHGAFQELRNESMVTAAAAAAAAVAQEQHRQ
QLHQHQQQQQQQQQHQQQQQQQQQQQQQHQQQQQQQARGRDGMKLKQNCSANASPEVKQI
LNCFILSRKSQAAASNGTTTTSPYRNRGVVKSSSGESLPAGTVTSAHPYKIPQPPPSLLK
YESDFPLRKTASEPNLLKIRLKQSVIERKARIGGPAGARRHERLLQAAQRRQQKNSVLTN
CNSTPDSGPNSPPSAAALAVGVVGSRGSPTSAPIQEENEEGSQYQPGQRSSINDLPLFSS
PSLPNISLGRPHLPNSAQAHAQVNAQVAAQAQAQAQAQAQAHAMFAALAAAQGGCGQPGY
YNPLGMAFVGRQPAPLAMIPATGIAPQQPSPVVRSASATSTSSSQASLVGDVAPPQAHAA
STILPSSSSYMQQLGSVAGSGVNLHAAAVAAAAAAAAAAGSLPPTNSHGHGHGTHAHAHG
HGHGHGLYAGHQHNVPITDAQVAQVHLHKQGHRPLGRTQSAPLPLGHPMLTGAVQLNVVQ
THYENSEAERQAYEHQVVNQKVRQTVLTRSGAAAAAAAAAGVSVVREAQLKEEDDDSAAE
VMDLTDKKKPPKTVLTTTIATSTSQNLPEALAAAAAAAAYRAPHTTSGNSLSASVTKSGI
KLRDQEYLQQQREQLLLLQQEEELAKSLMRPLSRTLSSPLVPLGPHGLSQIPDTGQQPAP
IATSSSADHIPPVNLSLPHRQHRQLMSTLYASQLRNHQPSASGSPPHKVTTGLAYDPLML
KHSCICGDNAQHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQSVHTEAHAMLF
GSNQCQLSRPKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTA
KGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIVDWDVHHGN
GTQQAFYQSPDILYLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDA
EYIAAFRTVVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTRELLQLAN
GKVVLALEGGYDLAAICDSAQECVRALLGDPAAPIAKAELERPPCQNAINTLQKTIAIQQ
THWPCVRMLEHTVGLSALETLKVEHDESETINAMAGLSMQSMHRTLSRDDSEEPMDQDET
K
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcccgacgatagaataccaatacacgatctgccatcagaagccggaagcgat
gagcgattgctgcacataacgccggccactctgacattggacttcaagccccatcccgcc
gtggatatcgatcagcagatcatggagttgaagaagagccaggagctgcagaagcagcgg
cttatcaactcgtttcaggagcaatcgaagcaaatggaattggagcataaacttcaactg
gagcacaagtatcaatttgcggtgaattcacatggcgctttccaggaattgcgaaacgag
agcatggtgaccgccgccgctgctgcggccgctgcggtggctcaggagcaacatcgccag
cagttgcatcaacatcagcagcagcagcagcagcagcaacagcatcagcagcagcagcag
caacagcaacagcagcagcagcaacatcagcagcagcaacagcaacaggcacgcggcagg
gatggcatgaaactcaagcagaattgcagtgccaatgccagtcccgaggtcaaacagatt
ctcaactgcttcatcttgagcagaaagtcgcaggcggcggcttcgaatggcacaacgaca
acgtcgccctacaggaatcgcggcgtggtgaagagctcctcgggcgaatcccttccagct
ggaaccgtgaccagtgcgcatccgtacaaaatacctcagccgcccccctcactgctcaaa
tatgaatccgattttccgctgaggaagacagcatccgaacccaacctgctgaagatccgg
ctgaagcagagcgtcatcgagcgcaaggcccgcatcggaggaccggcgggagcccggcgc
cacgaacgactcctccaggcggcgcagcgcaggcagcaaaagaactcggttctcacaaac
tgcaacagtacaccggactctggacccaattcgccgccctcggcagccgcgttggcggtg
ggcgtggtcggcagccgtggatcaccgacgagtgcgcccatccaggaggagaacgaggag
ggcagccaatatcagccgggccagaggagcagcatcaacgatttgccactgttcagctcg
ccctcgctgccgaatatatcgctcgggcgaccgcatttacccaactcggcgcaggcgcat
gcccaggtgaatgcccaggtggctgcccaggctcaggcccaggcacaggcacaggcacag
gcgcatgccatgttcgcggcactggctgccgcccagggtggctgcggtcagccgggctac
tacaatccactgggcatggcattcgttggccgccaaccggcgccgctggccatgattccg
gccacggggatagcgccacagcaaccatcgccggtggtgcgcagtgcatcggccacctcg
acatcgtcgtcgcaggcctcgctggtgggcgatgtggcgccaccgcaggcgcatgccgcc
tccaccattctgccctcgtcctcgtcctacatgcagcaattgggcagtgtggccggttcg
ggggttaatctccatgccgccgccgtcgctgcagcggcagcagcagcagccgccgccggt
tcactgccaccgaccaatagccatggccatggacacggcacccacgcacatgcccatggg
catggacatggccatggcctctatgcgggccaccagcacaatgtgcccatcacggacgcc
caggtggcgcaggtgcatctgcacaaacagggccaccggccgctgggacgaacgcagtcg
gcaccactgccccttggccatccgatgctgaccggcgctgtgcagttgaatgtggtccaa
acgcactacgagaatagtgaggcggagcggcaggcgtacgagcaccaggtggttaaccag
aaggtccgtcaaaccgtccttactcgcagtggagctgctgcagcagccgctgctgccgcc
ggcgtgagtgtggtgcgtgaagcgcagctgaaggaggaggacgacgactcggctgccgag
gtaatggaccttacagacaagaagaaaccgccgaaaacggtgctgaccacgacgatagcc
accagtacgtcccagaatctgcccgaagctttggcagcggcggcggcagcagccgcttac
cgtgcgccgcacaccacgtccggtaactccctctccgcctccgtcacaaagtctggtatt
aagctgcgggaccaggagtatctgcaacagcaacgggagcagctattgctccttcagcag
gaggaagaactggccaagagcctgatgcgtccgctttcgcgaacactgagcagtccgctg
gtgccgctggggccacatggtcttagtcagatacccgacacaggacagcagccggcaccg
atagccacatcctcgtcggccgatcatataccgcccgtgaacctctcgctgccgcatcgc
cagcaccgccagctaatgagcaccctatatgccagccaattgcgtaaccatcagccatcg
gcgagtggttcaccgccgcacaaggtcaccaccggtttggcctacgatccgcttatgctg
aagcactcgtgtatttgcggggacaatgcccagcatccggagcacagtggccgattgcag
agcgtttgggcacggctcaatgaaacggatctggtgaagcgttgcgatcgcctgcgcgct
cgcaaggcgacgcaggaggagctgcagagtgtgcacacagaggcgcatgccatgctcttc
ggttcgaatcagtgtcagttgagcaggcccaagttggagaacacgttgtcggccagcttt
gttcgtctatcgtgcggcggtttgggcgtggatctggataccacgtggaatgagcatcat
acggccaccgctgcacgaatggcagccggttgtgttatcgatttggcgctaaaaacggcc
aagggtgacctgcggaatggttttgccgttgtgcggccgccgggccatcatgcggaggcc
aatctggccatgggcttctgtttcttcaattcgatcgccattgcggccaagctgctacgt
cagcggatgcccgaggtgcggcgcatcctcattgtcgattgggatgtgcatcacggcaat
ggcacacagcaagcattctaccaaagtcccgacattctatatctttccatacatcgacac
gatgacggtaacttctttcccggcacaggtggacccacagagtgcggctccggtgctggt
ctcggctttaatgtgaacatctcatggtctggggcgcttaatccgccactgggcgacgcc
gagtatatcgctgcattccgtaccgttgtgatgcccatcgcgcggagctttaatccggac
attgtgctggtatcctccggtttcgatgcggccaccggccatccggcaccgctgggtggc
taccatgtctcaccggcctgctttgggttcatgacccgcgaactacttcagttggccaac
ggcaaagtggtgctggccctcgagggcggctacgatctggccgccatctgtgattccgcc
caggagtgtgtgcgggcgctgctcggcgatcccgctgctcccatagctaaggccgagctg
gagcgtccgccctgccagaatgccatcaatacgctccagaagacgatagccattcagcaa
acgcactggccctgcgtgagaatgctggagcatacggtgggcttgtcggcgctggagacg
ctcaaggtggagcacgacgagtccgagacgatcaacgccatggctggcctctcgatgcag
tcgatgcacagaactctatcccgcgatgattccgaggagccgatggaccaggatgaaacc
aaatag

DBGET integrated database retrieval system