KEGG   Drosophila yakuba: Dyak_GE18573Help
Entry
Dyak_GE18573      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dya  Drosophila yakuba
Pathway
dya04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dyak_GE18573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dya01002]
    Dyak_GE18573
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dya04147]
    Dyak_GE18573
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dyak_GE18573
Peptidases [BR:dya01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dyak_GE18573
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE18573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 6527358
NCBI-ProteinID: XP_002088450
FlyBase: FBpp0263583 FBgn0235980
UniProt: B4P1Z1
LinkDB All DBs
Position
2L
AA seq 270 aa AA seqDB search
MIANGQQTQSLASVLLLVLGIAQISGVAIGVPEGRVVGGGPAAVNSAPYAVSMQYGGTHY
CAASILNVNWLVTAAHCLTNSNQVLGSTLVAGSIEVAGTASTTQTRSITYFVINDLYTGG
TVPYDIGLIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVA
TNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWG
KLPCGQANSPSVYVQVSSFISWISANQQAP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgaacggacagcaaacacagtcgttggccagtgtgctgctcctggtactgggc
attgcccaaatatccggagtggctattggcgtaccagaggggcgagtggtgggcggaggt
ccggcggcggtgaacagtgctccctatgcggtgtccatgcagtacggaggcacccactac
tgtgcggccagcatcctgaatgtcaactggctggtcaccgccgcccactgcctgaccaac
agtaaccaggtgctgggcagcacactggtggccggaagcatcgaggtggccggaactgcg
agcactacgcagacgcggagcatcacgtatttcgtgatcaatgacttgtacaccggtggc
accgttccctacgacatcggattgatctacacgcccaccgccttcgtttggagcgccgcc
gtggctccagtaacgcttccatcctcgggagttgtgcccactggcaccgccaatctgtac
ggatggggcagcaccagcaccacgaataccgcctcctatccatccaccctacaggtggcg
accaatgtgcccatcatctcgctgagctcctgcgagagcgccctgggcaccaagggcagc
gatgtccactcgaccaatctgtgcactggtccactgaccggcggcgttagcatttgcacc
tcggattcgggaggaccactggtccagggcaatgtcctcatcggcatcgtgtcctggggc
aagttaccctgtggccaggccaactcaccatcggtttacgtgcaggtctcgtcgtttatt
tcctggatatcggctaaccagcaggcgccctga

DBGET integrated database retrieval system