KEGG   Drosophila yakuba: Dyak_GE18785Help
Entry
Dyak_GE18785      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dyak_GE18785
Peptidases [BR:dya01002]
 Metallo Peptidases
  Family M2
   Dyak_GE18785
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE18785
CD molecules [BR:dya04090]
 Proteins
  Dyak_GE18785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Chorion_2
Motif
Other DBs
NCBI-GeneID: 6527758
NCBI-ProteinID: XP_002088838
FlyBase: FBpp0263795 FBgn0236171
UniProt: B4NXF9
LinkDB All DBs
Position
2L
AA seq 630 aa AA seqDB search
MGACNITVLLLVIMLWLPHGLSMGNSCSASVLEARRFFELENEQLRRRFHEEFLSGYNYN
TNVTEANRQAMIDVYARNAELNKRLAQQIKASDYIQSEDADIRRQAEHLSKLGASALNAD
DYLALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHD
KAGTPMRENFAEYVRLTRKASQLNGHRSYADYWVQFYEDPDFERQLDATFKQLLPFYRQL
HGYVRFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKAEMEK
QGYTVQKLFELGDQYFQSLGMRALPPSFWNLSLLTRPDDRQVVCHASAWDFYQDSDVRIK
MCTEVDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLK
AIGLLENGRLDEKSRINQLFKQALSKIVFLPFGYAVDKYRHAVFRNELDESQWNCGFWQM
RSEFGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRKAGQYAPNN
SRLTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEFTGETEMDPAALLEYFEPLYQW
LKQENSRLGVPLGWGPTGKIPSDCCGTFST
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgggggcatgcaatataaccgtcttattgctggtcatcatgttgtggctaccccatgga
ctgtccatgggcaatagctgctcggcatcggtgctggaggcgcgcaggtttttcgagctg
gaaaatgaacaactacgaaggcgcttccacgaggaattcctttccggttacaactataac
accaatgtaacggaggcgaaccgccaggccatgatcgatgtgtatgcccgcaatgcggag
ctcaataagcgcctggcccagcagataaaggcctccgattacattcagtccgaggatgcg
gatatacgacgacaggccgagcatctctccaaactgggagcatccgccctgaatgctgac
gactacctggccctgcagaatgccatcagttccatgcaaacgaattatgccaccgccacc
gtgtgctcatacaccaatcgcagtgattgctcgctcacactggagccgcacatccaggag
cgtctgtcccacagccgtgatcctgccgagctggcttggtactggcgggagtggcacgat
aaggccggaactcccatgcgggagaacttcgccgagtacgtgcgtctgacgcgcaaggca
tcccaattgaatggtcaccgctcctacgccgactactgggtgcagttctacgaggacccg
gactttgagcgccaactggatgccacatttaagcagctgctgcccttctaccgacagctc
cacggctacgttcgcttccgtttgcgacagcactacggtccggatgtgatgccggcagag
ggaaacattcctattagcctgctgggcaacatgtggggtcagtcgtggaacgagctgctc
gatttgttcacgccctatccggagaagccgtttgtggacgtgaaggccgaaatggagaag
cagggatacacggtgcagaagctgtttgagctgggtgatcagtacttccagtcgctcggc
atgcgcgccctgccgcccagtttctggaatctaagtctgctcacccgtcccgacgatcgt
caggtggtttgccacgcctccgcctgggacttttaccaagacagcgatgtgcggatcaag
atgtgcaccgaagtggactcccactacttttatgtggtgcatcatgagctgggacacatc
cagtactatttgcaatacgagcaacagccggctgtctaccggggagcacccaatcctggc
ttccatgaagctgtgggcgatgtgattgccctatccgtgatgtcggccaagcacttgaag
gccattggcctgctcgaaaatggtcgactagacgaaaagagtcgtatcaatcagttgttc
aagcaggccctctccaagattgtcttcctgccctttggctacgccgtggataagtatcgc
catgccgtttttcgcaacgaattggatgagtcgcaatggaactgcggcttctggcagatg
cgatccgagtttggcggcgtcgaaccaccagtattccgcaccgaaaaggactttgacccg
ccagccaagtaccacattgatgcagacgtggagtacctgcgctactttgccgcccacatc
ttccagtttcagttccacaaggccctgtgccgcaaggccggccagtatgcgcccaacaac
agtcgcctgactctggacaactgtgatatcttcggcagcaaggcagctggacgatcacta
agccagttcctctcaaagggcaactcccgccattggaaggaggtgctggaggagttcacg
ggcgaaacggaaatggacccagccgctctgctggagtactttgaaccgctgtaccagtgg
cttaagcaggagaacagtcgcttgggcgtcccattgggctggggaccaacaggcaaaatc
ccctctgattgctgtggaacatttagcacctag

DBGET integrated database retrieval system