KEGG   Drosophila yakuba: Dyak_GE19201Help
Entry
Dyak_GE19201      CDS       T01068                                 

Gene name
Dyak_Mal-A2
Definition
(RefSeq) maltase A2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dya  Drosophila yakuba
Pathway
dya00052  Galactose metabolism
dya00500  Starch and sucrose metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dyak_GE19201 (Dyak_Mal-A2)
   00500 Starch and sucrose metabolism
    Dyak_GE19201 (Dyak_Mal-A2)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dyak_GE19201 (Dyak_Mal-A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6528595
NCBI-ProteinID: XP_002089638
FlyBase: FBpp0264211 FBgn0236559
UniProt: B4P2T9
LinkDB All DBs
Position
2L
AA seq 567 aa AA seqDB search
MPKWAHLGLAVLLSICTSLGGAAEIDWWENASLYQIYPRSFQDSDGDGIGDLKGITSRLG
YLKEIGITATWLSPIFTSPMSDFGYDISNFYDIDPIFGTLDDFDALIVEAKSLGVKIILD
FVPNHSSDENVWFEKSVNREDGYDDFYVWDDGKLNEETGEREAPSNWVSVFSGPMWTWNE
KRQQFFLHQFQVKQPDLNFTNPMVREHMLDVLKFWLDRGVDGFRIDAVPHIYEHRNADGS
YPDEPVSGWGSDPNAYDYHDHIYTKDQPATVDLMYEWREFLDNYRAQNGGESRVLLAEAY
SSVETLSAYFGNSTHHGTQLPMNFQLMYLSGYSTAEDVVGSIDYWMNTMWKEHQTANWVI
GNHDTKRVADRMGAHKVDLLNVIVNALPGASVTYYGEEIGMSNVDVECTGDSCEDRDGER
TPMQWTAGKNADFSDGESTWLPLSPEYQRYNVQTERGVSRSSLNIFKGLQALKSSAAFMA
FKEDGGFSYEAVTKQVLQIIRTNKISEEYRILVNMGNDIEILDGLVSKTYEYVLATAYST
HYPGQKADLSARIILMPYEAVVLRWLA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtgggcacatctcggcctagcggttctcctttcaatttgcacttccctaggg
ggagctgcggagatcgattggtgggagaacgcctcgctttaccagatatatccgcgctcc
ttccaggacagcgatggcgatggcatcggggacctgaaaggtattacttcgaggttgggc
tatctcaaggaaataggcatcacggccacctggctgtcgcccatttttacctcgcccatg
tcggatttcggatacgacatctccaacttctacgacatcgatccgatattcggcactctc
gacgatttcgatgcccttatagtggaggccaagtcgttgggcgtaaagatcatcctcgac
tttgtacccaaccactcgagtgacgagaacgtgtggtttgaaaaatccgtgaatcgcgag
gatggatacgacgacttctacgtgtgggacgacggaaagctaaacgaggaaactggtgaa
agagaggctccttctaattgggtcagtgtgttcagcggacccatgtggacgtggaacgaa
aagcgccagcagttcttcctgcaccagtttcaggtgaagcagccggatctaaactttacc
aatccaatggttagagagcacatgctggatgtcttgaagttttggctggaccgcggagtc
gatggattccgtattgatgcagttccacacatctacgagcaccgcaatgcagacggctcc
tatccggatgaaccggttagcggttggggtagtgaccccaacgcctacgactaccacgat
cacatctacaccaaggatcagccggccacggtggatctcatgtacgagtggcgggagttt
ttggataactatcgagcgcagaatggaggcgaatcacgggttctgctcgccgaggcctat
tcttccgtggagactctgagtgcttatttcggaaacagcacccatcacggtacccagctg
cccatgaacttccagttgatgtatctcagtggctactcaaccgcggaggatgttgtggga
tccatcgactactggatgaataccatgtggaaggagcaccagacggccaactgggtcatt
ggtaatcacgacaccaaaagagtggctgatcgtatgggagctcacaaagtggatttgctc
aatgtgattgtgaacgctctgccaggagcttcggtgacctactacggcgaggaaatcggc
atgtccaacgtggacgtggagtgcaccggcgactcttgcgaggatcgcgatggagagcgc
acgccaatgcagtggacagctggaaagaacgccgacttttctgatggggagtctacctgg
ctgccactaagccccgagtatcagaggtacaatgtgcagactgagcgcggggtttccaga
tcttccctgaacatctttaagggtcttcaagctcttaagagcagtgccgcttttatggcg
tttaaagaggatgggggtttctcctatgaggcggtgacgaagcaagttctacagatcatt
cgcacaaacaagatcagcgaggagtacagaattctggtcaacatgggcaacgatattgaa
atcctcgatgggctggtctccaaaacctacgagtatgtgctggccacagcctactctaca
cactatccggggcaaaaagcagatctgtcagcgagaatcattctcatgccctatgaagca
gtcgttttacgatggttggcataa

DBGET integrated database retrieval system