KEGG   Drosophila yakuba: Dyak_GE20749Help
Entry
Dyak_GE20749      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dya  Drosophila yakuba
Pathway
dya00480  Glutathione metabolism
dya00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dyak_GE20749
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dyak_GE20749
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dyak_GE20749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 6532703
NCBI-ProteinID: XP_002093445
FlyBase: FBpp0265759 FBgn0238050
UniProt: B4PG13
LinkDB All DBs
Position
3L
AA seq 243 aa AA seqDB search
MSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTEKPEW
LLDKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKMLIER
FGAVLGAFFKASDGGDLEPFWSGLDIYERELTRRGTDFFGGEQTGILDYMIWPWCERLDL
LKLQRGEDYNYDEGRFPQLTLWVERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacggcaggcatttggcaaaaggctcacccatgccggatgtacccgaagatggt
atccttcgcctgtactcaatgcgcttctgcccatttgcccaacgagtgcatctggtcctg
gacgccaagcagataccgtatcacagcatttacattaatctcacagagaagccggagtgg
ctgctggacaagaatccgcagggcaaggtgccggctctggaaattgtgcgagaacctgga
ccaccagtgctcacagagtcgctgctgatttgtgaatatctggacgagcagtatccactg
cgaccactctatccacgtgatccgctgaaaaaagtgcaggataagatgctaatcgagcga
tttggagcggtgctaggtgcgttctttaaggcatccgatggcggtgatctggagcccttc
tggagcggcctggacatctacgaaagggagctgactcgccgtggtacagatttctttggt
ggcgagcagacgggcattctggactacatgatttggccctggtgtgagcgtctcgatctc
ctcaagttgcagcgtggagaggattacaactacgatgagggccgctttccgcagctgact
ctttgggtggaacgcatgaaacgagatccggctgtgatggccttctacatggaggccgag
gttcaggcagagttcttgcgcacacgcagcttgggccgacccaactacaatttgctggtg
aaggatgcttga

DBGET integrated database retrieval system