KEGG   Drosophila yakuba: Dyak_GE22077
Entry
Dyak_GE22077      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20014  cell death protein rpr
Organism
dya  Drosophila yakuba
Pathway
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE22077
   04215 Apoptosis - multiple species
    Dyak_GE22077
SSDB
Motif
Pfam: Bunya_NS-S
Other DBs
NCBI-GeneID: 6534224
NCBI-ProteinID: XP_002094906
FlyBase: FBpp0363449 FBgn0239307
UniProt: B4PJ27
LinkDB
Position
3L
AA seq 65 aa
MAVAFFIPDQATLLREAEQKEQQILRLRESQWRFLATVVLQTLRQYSPCHPKTGRKCGKY
RKPSQ
NT seq 198 nt   +upstreamnt  +downstreamnt
atggcagtggcattcttcatacccgaccaggcgaccctgctgcgggaggcagagcagaag
gagcagcagatcctccgcttgcgggagtcccagtggagattcctggccaccgttgtcctg
caaacgctgcgccagtacagtccatgtcatccgaagaccggcagaaagtgcggcaaatac
cgcaaaccatcgcagtaa

DBGET integrated database retrieval system