KEGG   Drosophila yakuba: Dyak_GE22078
Entry
Dyak_GE22078      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20018  cell death protein Grim
Organism
dya  Drosophila yakuba
Pathway
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE22078
   04215 Apoptosis - multiple species
    Dyak_GE22078
SSDB
Motif
Pfam: GAF_2 TFIIA DUF2367
Other DBs
NCBI-GeneID: 6534225
NCBI-ProteinID: XP_002094907
FlyBase: FBpp0355745 FBgn0239308
UniProt: B4PJ28
LinkDB
Position
3L
AA seq 142 aa
MAIAYFIPDQAQLLARSYQQSGHQAAASPRTTAAPAAPSQQQQQSQQQPHQQQHQQQQQR
PQIRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIYSYSSSQRRPTVIQISFEISS
GSQNNDEDDVTDATSTSTTKEN
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccatcgcctattttatacccgaccaggcccaattgttggccagaagctaccagcaa
agtggccaccaggcagcagcgagtcctcggacaactgcagcacctgctgcaccttcgcag
cagcagcaacaatcgcaacagcagccgcatcagcagcaacatcagcagcaacaacagcgc
ccacaaatccgtgccaatatctccgtgccgctgggaagtcaacagggatcgatgaccatg
tcggagttcggatgctgggaccttctggcccagatcttctgctacgccctgagaatctac
agctacagttcgagccagcgacgaccgacggtcattcagatatccttcgaaatcagcagc
ggcagccagaacaacgatgaggacgacgtgaccgatgccacctccacctccaccaccaag
gagaactaa

DBGET integrated database retrieval system