KEGG   Drosophila yakuba: Dyak_GE22086
Entry
Dyak_GE22086      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20016  cell death protein hid
Organism
dya  Drosophila yakuba
Pathway
dya04013  MAPK signaling pathway - fly
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE22086
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE22086
   04215 Apoptosis - multiple species
    Dyak_GE22086
SSDB
Other DBs
NCBI-GeneID: 6534234
NCBI-ProteinID: XP_002094916
FlyBase: FBpp0267096 FBgn0239316
UniProt: B4PJ37
LinkDB
Position
3L
AA seq 417 aa
MAVPFYLPEGGADDVASSSSGASGNSSPHNHPLPSSASSSVSSSGVSSASASSASSSSSS
SASSDGASSAASQSPNTTTSSATQTPMQSPLPTDQVLYALYEWVRMYQSQQSAPQIFQYP
PPPSPSCNFTGGDVFFPHGHPNPNPNSNPHPRTPRTSVSFSSGEEYNFFRQQQPQPHPSY
PAPSTPQPMPPQSAPPMHCSHSYPQQSAHMMPHHSAPFGMGGTYYAAYTPPPTPNTASAG
TSSSSAAFGWHGHLHSPLTSTSTPLSAPVAPKMRLQRSQSDAARRKRLTSTGEDEREYQS
DHEATWDEFGDRYDNFTAGRERLQEFNGRIPPRKKKSSNSHSTSSNNPVCHTDSQPDNAS
QAESGATNGHISQQRQVERERERQKAKAEKKKPQSFTWPTVVTVFVLAMGCGFFAAR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatttgcccgagggcggcgccgatgacgtagcgtcgagttcatcg
ggagcctcgggcaactcctccccccacaaccacccactcccctcgagcgcatcctcctcc
gtctcctcctcgggcgtgtcctcggcctccgcctcctcggcctcgtcatcgtcttcgtcc
tccgcatcctcggacggcgccagcagcgccgcctcgcaatcgccgaacaccaccacctcg
tcggccacgcagacgccgatgcagtctccactgcccaccgaccaggtgctgtacgccctc
tacgagtgggtcaggatgtaccagagccagcagagcgccccgcaaatcttccagtatccg
ccgccgccgagcccctcttgcaatttcacgggcggcgatgtgttctttccgcacggccac
ccgaatccgaatccgaactcgaatccccacccgcgcaccccccgcaccagcgtgagcttc
tcctccggcgaggagtacaacttcttccggcagcagcagccgcagccacatccgtcgtat
ccggcgccatcgacaccgcagccaatgccaccgcagtcagcgccgccgatgcactgcagc
cacagctacccgcagcagtcggcgcacatgatgccacaccactccgctcccttcgggatg
ggcggcacctactacgccgcctacacgccgccacccactccgaacacggccagcgcaggc
acctccagctcatcggcggccttcggctggcacggccacctccacagccccctcacatcg
acctccacgcccttatcggcgccagtggcgcccaagatgcgcctgcagcgcagccagtcg
gatgcggccagacgcaagcgattgacctcgacgggcgaggatgagcgcgagtaccagagc
gatcatgaggccacttgggacgagtttggcgatcgctacgacaactttacggccggccgg
gagcgtctgcaggagttcaatggacgtattccgccccggaagaagaagagctccaatagc
cactccaccagcagcaataatccagtctgccataccgacagccagccggacaatgcctcc
caagcggagagcggtgccaccaatggccacatcagtcagcagcgacaggtggagcgggag
cgggaacggcagaaggcgaaggcagagaagaagaaaccacagagcttcacttggccaact
gttgtgaccgttttcgtcttggccatgggctgtggcttctttgcggcgcgatga

DBGET integrated database retrieval system