KEGG   Drosophila yakuba: Dyak_GE22200Help
Entry
Dyak_GE22200      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
dya  Drosophila yakuba
Brite
KEGG Orthology (KO) [BR:dya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dya01001]
    Dyak_GE22200
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     Dyak_GE22200
Protein kinases [BR:dya01001]
 Non-receptor tyrosine kinases
  ABL family
   Dyak_GE22200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6534426
NCBI-ProteinID: XP_002095103
FlyBase: FBpp0359159 FBgn0239427
UniProt: B4PKB7
LinkDB All DBs
Position
3L
AA seq 1662 aa AA seqDB search
MGAQQGKDRGAHSGGGGSGAPVSCIGLSSSPVASVSPHCISSSSGVNSAPLGGGSTLRGS
RIKSSSSGVASGSGSGGGGGSGSGLSQRSGGHKDARCNPTVGLNIFTEHNGTKHSSFRGH
PGKYHMNLEALLQSRPLPHIPAGSTAASLLADAAELQQHQQDSGGLGLQGSSLGGGHSST
TSVFESAHRWTSKENLLAPGPEEDDPQLFVALYDFQAGGENQLSLKKGEQVRILSYNKSG
EWCEAHSDSGNVGWVPSNYVTPLNSLEKHSWYHGPISRNAAEYLLSSGINGSFLVRESES
SPGQRSISLRYEGRVYHYRISEDPDGKVFVTQEAKFNTLAELVHHHSVPHEGHGLITPLL
YPAPKQNKPTVFPLSPEPDEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYGNTVAVKTLK
EDTMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRET
LDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYT
AHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPGIDLTDVYHKLEK
GYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMFQESSITEAVEKQLNANA
TSASSSAPSTSGVATGGGATTTTAASGCASSSSATASLSLTPQMVKKGLPGGQSLTPNAH
HNDSHQQQASTPMSETGSTSTKLSTFSSQGKGNVQMRRTTNKQGKQAPAPPKRTSLLSSS
RDSTYREEDPATARCNFIDDLSTNGLARDINSLTQRYDSETDPAADPDTDATGDSLEQSL
SQVIAAPATNKMQHSLHSGGGGGGIGPRSSQQHSSFKRPTGTPVMGNRGLETRQSKRSQH
HPLAPGPGPPATQPHHGNNGVVASAHPITVGALEVMNVKQVVNRYGTLPKVARIGAYLDS
LEDSTEAAPALPATAPALPPANGHATPPAARINPKASPIPPQQMIRSNSSGGVTMQNNAA
ASLNKLQRHRTTTEGTMMTFSSFRAGGSSSSPKRNATGAASGVQPALANLEFPPPPLDLP
PPPEEFEGGPPPPPPAPESAVQAIQQHLHAQLPNNGNISNGNGTNNNDSSHNDVSNTAPS
VEEASSRFGVSLRKREPSTDSCSSLGSPPEDLKEKLITEIKAAGKDSAPASQLANGSGIA
VVDPVSLLVTELAESMNLPKPPPQQQKLTNGNGTGSGFKAQLKKVEPKKMSAPIAKAEPA
NTIIDFKAHLRRVDKEKEPAAPAPAPVAVTNNANCNTTGTLNRKEDSSKKFSQAMQKTEI
KIDVTNSNVEADAGAAGEGDLGKRRSTGSINSLKKLWEQQPPAPDYATSTILQQQPSVVN
GGGTPNAQLSPKYGMKSGAPNTGGTLPAKLGNKPPPAAPPPPPPNCTTSNLSTTSISTSS
RDCTSRQQASSTIKTSHSTQLFTDDEEQSHSDGLGSGGQGAADMTQSLYEQKPQIQQKPA
VPHKPTKLTIYATPIAKLAEPASSASSTQISRDSILELVGLLEGSLKHPVNAIAGSQWLQ
LSDKLNILHNSCVIFAENGAMPPHSKFQFRELVTRVEAQSQHLRSAGSKNVQDNERLVAE
VGQSLRQISNALNRXMIRRGMDAPDQHQGIWLDAEGNFIKRK
NT seq 4989 nt NT seq  +upstreamnt  +downstreamnt
atgggggctcagcagggcaaggacaggggcgcccactcgggagggggcggctcgggggcc
cctgtcagctgcatcggcctctccagcagcccagtggcctccgtctccccccactgcatc
tccagttccagtggcgtcaacagcgcccccctcggcgggggctccacgctccgtggctcc
cgcatcaagtcctcgtcctccggcgtggccagtggcagcggatcagggggcggcggtgga
tccggatcggggctgagccagcgcagtggtggacacaaggatgcacgctgcaatcccacc
gtgggtctcaacatattcaccgagcataacggtaccaagcacagctcttttcgcggccat
ccaggcaaatatcacatgaacttagaagccctgctgcagtcgcgtccattacctcacatt
ccggccggaagcacggcggcctctcttctggcggatgcggctgagctgcagcagcatcag
caggattccggtggactgggactgcaaggctcctccttgggcggtggtcacagttcgact
acatccgtgtttgagtccgcacaccggtggacctcgaaggagaacctgctggcccccgga
cctgaggaggatgatccgcaactgttcgtggcgctgtacgacttccaagccggcggagag
aaccaattgagtctgaagaagggcgagcaggtgcgcatacttagctacaacaaatcgggg
gagtggtgcgaggcgcactcggactctggaaacgtgggatgggtgccctccaactacgtc
acgccgctcaactcgctggagaagcactcctggtaccacggacctatctcacgcaatgcc
gccgagtaccttctcagctccggaatcaatggcagcttcctggtccgtgaaagcgaaagt
tcaccgggtcaaaggagcatcagtctcagatacgagggtcgcgtctatcactaccgcatc
tcagaggatcccgatgggaaggtcttcgtcacccaggaggccaagttcaacactctggcc
gagctggtgcaccaccacagcgtgccccatgagggtcacggcctgatcactccgctcctg
tatccggcgcccaagcagaacaagcccactgtcttcccgctgagtcccgagccggatgaa
tgggagatctgccgaactgacatcatgatgaagcacaagctgggcggggggcagtacgga
gaggtctacgaggccgtttggaagcggtacggcaacacggtggctgttaaaacgctcaag
gaggacaccatggcgctgaaggacttcctcgaagaggcggccattatgaaggagatgaag
caccctaatctggtgcagctcataggtgtttgcaccagggaaccgccgttctacatcatc
accgagttcatgtcgcacggtaatctgctggacttcctgcgctccgccggccgcgaaacg
ctcgacgcagtggctctgctgtacatggccacgcagatagcgtcgggaatgagctacctg
gagtcgcgcaactacatccatcgcgatctcgctgcccgcaactgcctcgtgggcgacaac
aagctggtcaaggtggcggatttcggactagcacgcctgatgcgggacgacacgtatacg
gcacatgccggagccaagttcccgatcaaatggaccgcaccggagggtctggcctacaac
aagtttagcactaagtcggacgtttgggccttcggtgtcctgctgtgggagatcgccacg
tacggaatgtcgccgtatccgggcatcgacctgaccgacgtgtaccacaagctggagaag
ggctatcgcatggagcgacccccaggctgtccgccggaggtgtacgacttgatgcgccag
tgctggcagtgggatgccaccgacaggcccacgttcaagagcatacaccatgcgctggag
cacatgtttcaggaatcgtccatcaccgaagcggtcgagaagcagctgaacgccaacgcc
accagcgcgagcagctccgctccgagcacatcgggcgtggccaccggcggaggagccaca
accacgacggcggccagcggctgcgcttcctcatcctcggccaccgcctcgctaagtctt
acaccgcagatggtgaagaagggtttgcccggcgggcagtccctcacgccgaacgcccat
cacaacgattcgcaccagcagcaggccagcacgcccatgtcagaaaccggctccacttcc
accaaactaagcactttctccagccagggcaagggcaacgtccagatgcgtcgcaccacc
aacaagcagggcaagcaggcgcccgccccaccaaagcgaaccagcctgctctcgagcagt
cgggactccacttatcgcgaggaggatcctgccaccgccagatgcaatttcatcgacgac
ctcagcacgaatggattagcacgagacatcaacagtttgacgcagcggtacgactccgaa
acggatccggcagccgacccagacacagatgccaccggcgacagtctggagcagagtctg
agccaagtgatagccgctcctgccaccaacaagatgcagcattctcttcacagcggcgga
ggaggaggaggcataggtcctcgatcctcgcagcagcacagctccttcaagcgtccgact
ggaacacccgtgatgggtaaccgagggctagagacccggcagagcaagcggtcccagcac
catccactcgctccaggtcccggaccgccagcaactcaaccgcatcatggcaacaacggt
gtggtagccagtgcccatcccatcacagtgggagcgctggaggtgatgaatgtcaagcag
gtggtgaaccgctacggcacactacccaaagttgcccgaatcggtgcctatctggacagc
ctagaggacagtactgaggctgctcctgctcttccggccactgctcctgctctgccacca
gccaatggacacgccacgcctccggctgccagaattaatccaaaggccagtcccattccg
ccacagcaaatgatcaggagcaactcgtcgggaggtgtgaccatgcaaaacaatgcggcc
gccagcttgaacaagttgcagcgacatcgcaccactaccgaaggcaccatgatgacgttc
tcctccttccgggccggcggttccagtagctcgcccaagcggaatgccacgggagctgca
tcaggagtacagccagccctggccaaccttgagtttccaccgccaccgttggatttgcct
ccaccgcccgaggaattcgaggggggaccaccgcctcctccaccggcgccggagagcgct
gtgcaggccatccagcagcacttgcatgcccagctgccaaacaatggcaatataagcaat
ggaaacggaacaaacaacaacgacagcagccacaacgatgtaagcaacactgctcccagt
gtggaggaggccagctccagatttggagtgtctctgagaaaacgcgagccctccaccgac
tcctgcagctcgctgggcagtccacccgaggatctcaaggagaagctaatcaccgaaatc
aaagcggctggcaaggatagtgctccggcctcacaactggcaaacggatcgggcatcgca
gtggtggatcctgtctccctgcttgtcaccgaactagccgagagcatgaacctcccaaag
ccgccgccgcagcagcaaaagctgaccaacggcaatggtactgggtccggattcaaggct
cagctgaagaaagttgaacccaagaagatgagtgcgccaatcgccaaagcggagccggcc
aataccatcatcgacttcaaggcccatctgcgccgagtggacaaggagaaggagccggca
gctccagctccggctcctgtagccgtaacaaacaatgccaactgcaatacaacgggcact
ttgaaccggaaggaggacagcagcaagaagttctcccaggcgatgcaaaagactgaaatc
aaaatcgacgtaaccaactcgaatgtggaggcggatgcaggagcagcgggagaaggcgat
ctcggcaagcgacgaagcacaggtagtattaatagcttaaagaaactgtgggagcagcag
ccaccggcgccggattatgccaccagcacgatcctccagcagcagccgtcggtggtaaat
ggcggcggaacaccaaatgctcaactgtctcccaagtacgggatgaaatcgggagccccc
aatactggtggcactcttccagccaagctgggcaacaagccaccaccggcagcccctcca
ccaccgcccccgaactgcaccacctccaacctctccaccacatccattagcacctctagt
agagattgcaccagcaggcagcaggccagcagcacaataaaaacctctcattcaacgcaa
ctcttcacagatgacgaggagcagtcgcattcggacggtctgggatcgggaggccaagga
gcagcagacatgacccagtcgctgtacgagcagaagccccagatccagcaaaagccagcg
gtgccacacaagcccacaaagctgaccatctacgccacgcccattgccaaactggccgaa
ccagccagctccgctagctccacccagatatcgcgggatagcattctggagctggtcgga
ctgctggagggctcgctcaagcatccggtgaatgccatcgccggatctcagtggctgcag
ctgagtgacaagctcaacatcctgcacaactcgtgcgtgatcttcgcggagaacggagcg
atgccgccgcactccaagttccagttccgggaactggtcacgcgggtggaagcacagtcg
cagcacctgcgctccgccggcagcaagaacgtccaggacaacgagcgcctggtggccgag
gtcggtcagtcgctgcgtcagatctccaatgcgcttaacaggtaaatgataagacggggg
atggacgcgcccgaccaacatcagggcatctggctggatgccgagggtaacttcatcaag
cgcaagtga

DBGET integrated database retrieval system