KEGG   Drosophila yakuba: Dyak_GE22444Help
Entry
Dyak_GE22444      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
dya  Drosophila yakuba
Pathway
dya00250  Alanine, aspartate and glutamate metabolism
dya00280  Valine, leucine and isoleucine degradation
dya00410  beta-Alanine metabolism
dya00640  Propanoate metabolism
dya00650  Butanoate metabolism
dya01100  Metabolic pathways
Module
dya_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Dyak_GE22444
   00650 Butanoate metabolism
    Dyak_GE22444
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dyak_GE22444
   00280 Valine, leucine and isoleucine degradation
    Dyak_GE22444
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dyak_GE22444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dya01007]
    Dyak_GE22444
Enzymes [BR:dya01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Dyak_GE22444
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Dyak_GE22444
Amino acid related enzymes [BR:dya01007]
 Aminotransferase (transaminase)
  Class III
   Dyak_GE22444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 6534858
NCBI-ProteinID: XP_002095530
FlyBase: FBpp0267454 FBgn0239667
UniProt: B4PFU5
LinkDB All DBs
Position
3L
AA seq 486 aa AA seqDB search
MRSLWLNTLTKQSLYRLSTKRYSTNIEPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQ
FFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFHNEQNLKTLINRPALG
VFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNTPLTEQ
EKNSCMINIPPGAPKLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYR
YPLDENVAHNKKEDEKCLSEVQDLIQQYASKNPVAGIVVEPIQSEGGDNEASPEFFRSLQ
AICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPN
EPYRIFNTWMGDPGKVLLLEEIVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNST
RGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFR
KVLQAI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcttgtggctaaatacgttgaccaagcagagtctatataggttgagtaccaag
aggtactccaccaacattgagcccaaggaacctgtggtgaaaactaaatcaatacctggc
cccaagtcaattgagcttaagaaacaactggattctgttcaggccaccggaaccatccaa
ttctttgctgactacgaaaagtccattggaaattacatctacgacgtggatgggaatatt
ctactagatgtctacacccagatttcctcagtgccgctgggttacaaccatccgaggctt
tacaaggtctttcacaatgagcagaacctgaaaactttgattaacagacctgcacttggc
gtcttccctggcaaggagtggccagaaaaactgcactcagttctgctgaacattgctccg
aaaggactcaataaaatcacaacgatgatgtgtggttcgtgttcaaacgaaaatgcgtac
aagagcatctttatatggtaccagaacaaacttcggggtaatacacctcttaccgagcag
gagaagaattcctgcatgatcaacattcccccaggagctccgaaactcagtattctctca
ttcaagggagctttccatggccgaacattgggagccctctccaccacacactcgaagtac
atccataagctggacgttccgtcctttgactggcccattgcctcgtttcccgagtaccga
tatcccttggacgaaaacgtggcgcacaacaagaaggaggatgaaaagtgccttagcgaa
gtgcaggatctcattcagcagtacgccagcaagaatccggtcgccggaattgtggttgag
cccattcaaagcgaaggaggcgacaacgaggcatcgcccgagttcttcaggagcctccag
gctatttgcaagaagaacggcatcgccctgttgatcgatgaggttcaaaccggtggaggt
agcactggaaaattctgggcccacgagcacttcgagttggagagtccccccgatgtggtg
accttcagcaagaagctgcagttgggcggctacttccacaacgacgacttcattccgaat
gagccgtacaggatcttcaacacctggatgggcgatccgggtaaggtcctgctcctcgag
gaaatcgtgaaggtgattcaggaggaaaagctcctggccaacgtcgatgtggccggtaag
gttctgaagaacggtttgctgagcctagagaaggaattcccgcatatcttgaactccacc
cgcggccgtggaacatttttggcagttaattgcaccaacaccaaggtgcgagatcaaata
atcggcgctctaaagttgcacggcattcagaccggaggctgtggagaaatttccattcgg
ttccgcccagctttgatatttaaggaataccatgctaacatcgtcctagaccgcttccgc
aaggttcttcaagctatttaa

DBGET integrated database retrieval system