KEGG   Drosophila yakuba: Dyak_GE26397Help
Entry
Dyak_GE26397      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dya  Drosophila yakuba
Pathway
dya00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dyak_GE26397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dya03036]
    Dyak_GE26397
Enzymes [BR:dya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dyak_GE26397
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dyak_GE26397
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dyak_GE26397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo GTP_EFTU FYTT Dynamin_N
Motif
Other DBs
NCBI-GeneID: 6537217
NCBI-ProteinID: XP_002097775
FlyBase: FBpp0358872 FBgn0243423
UniProt: B4PS67
LinkDB All DBs
Position
3R
AA seq 637 aa AA seqDB search
MATAEAQIGVNRNLQKQDLSNLDVTKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIEKLLSSKQQRQQYEIKQRSLLRHLAELRRHSR
LRRLCTMPAPFSKPASVSSVDRRTTRRSTSQTSLSPSNSSGYGSVFGCEEHDVDKVQSDK
GFANLKRRRSSCADTLTPNSKRSKNNEGLIVKKPPKGEYVVERIECVEVDQYQPVFFVKW
LGYKDSDNTWESLANVADCAQMEEFVERHQQLYETYIAKVTTELEEQLEALPLMENITVA
EIDAYDPLNLQLDLILLAQYRAASSRSQREPQKIGERALRSMQLKRAQYSRRKQLVDLAL
FEERMNRVEKPSPPIRVENNVDLDTIDSSFKYIQDNIIGKGVPKPEAGLLGCKCIDENGV
EVCAASTKCCARMAGELFAYERSTRRLRLRPGGAIFECNSRCSCDSNCSNRLVQHGRQIP
LVLFKTSNGSGWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDKGRTYLFDLDYN
TAQDSEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEEL
SFDYIRADNEDLPYENLSTAVRVECRCGADNCRKVLF
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagcgcaaatcggtgtgaacaggaacttgcagaagcaggacctcagc
aacttggacgtcaccaaactaacgcctctgtcaccggaggtcatctcccgacaggcgacc
atcaacattggcaccatcggtcatgtggctcacggcaaatccacggtggtcaaagccatc
tccggcgtgcagactgtgcgtttcaagaacgaactggagcgcaacatcacaatcaagctg
gaacgcttaagcgaaaagaaaatcgaaaaacttttgagctctaagcagcagcgacagcag
tatgaaatcaaacagcgttcactgctgcggcatctcgccgaattgcggcggcatagccga
ttacgccgcctctgcacgatgccagctccgttttccaagccagcatccgtctccagtgta
gatagacgcaccacccggcgaagcaccagtcagacctcactgagtcccagcaatagtagc
ggctatggcagcgtttttggctgcgaggaacatgatgtggacaaagtacaaagtgacaag
ggattcgccaatctgaagcgtcgacgcagcagttgtgcggacaccctaactcccaactcc
aagcggtcaaagaataatgagggattaatagtcaaaaagccacccaaaggggagtatgtc
gtggagcgtattgaatgcgtcgaggtggaccaatatcagccagtcttcttcgtgaaatgg
ttgggttacaaggacagcgataacacctgggaaagccttgccaacgtggccgactgcgcc
caaatggaagagtttgtggagcggcatcagcagctctacgagacatacatagctaaggtc
accactgaacttgaggaacagctggaggccttgccactaatggaaaacattactgtggcc
gaaatagatgcctatgatcccctcaatctgcagcttgatcttatcctactcgcccaatat
cgcgctgccagcagtcgaagccaaagggagccgcagaaaattggagagcgcgccttgaga
agcatgcaactgaagcgggcccaatattcacggcgcaaacagctggttgatttagcattg
tttgaggagcgcatgaatcgtgtggagaaaccgtcacctccaatacgcgttgagaacaac
gtagatctggacaccatagacagcagtttcaagtacatacaggataacataatcggaaaa
ggtgtgcccaagccggaagcggggcttctaggctgtaagtgcattgacgagaatggcgta
gaggtgtgtgctgcctctacgaagtgttgtgcccgcatggccggcgagctgtttgcctac
gagcgaagtacacggcgcttgcgccttcgtcccggtggcgccatcttcgagtgcaatagc
cgctgctcgtgcgattcaaactgctccaaccgactggtgcagcatggacgccagataccg
ttggtgctgtttaagaccagcaacggcagcggatggggggtgcgagccgcaactgccctg
cgtaagggtgaatttgtgtgtgagtacattggggagatcatcaccagcgatgaggcaaat
gagcgcggaaaggcgtacgacgacaagggaaggacatatctgttcgatttggattacaac
acagctcaggacagcgagtacactatcgatgcggctaactatggcaacatctcgcacttt
atcaatcactcttgcgatcctaatctggccgtgttcccctgctggatcgagcacttgaat
gtcgccctgccgcacctcgtgttctttacactacgcccaatcaaggcgggcgaggagctg
agcttcgactacatccgcgcggacaacgaagacttgccctacgagaacctctcgacggct
gtgcgcgtcgagtgccgctgcggagctgataattgcagaaaggtcctcttttga

DBGET integrated database retrieval system