KEGG   Drosophila yakuba: Dyak_GE28239Help
Entry
Dyak_GE28239      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
dya  Drosophila yakuba
Pathway
dya00061  Fatty acid biosynthesis
dya01100  Metabolic pathways
dya01212  Fatty acid metabolism
Module
dya_M00082  Fatty acid biosynthesis, initiation
dya_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dyak_GE28239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dya01004]
    Dyak_GE28239
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dya04147]
    Dyak_GE28239
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     Dyak_GE28239
Lipid biosynthesis proteins [BR:dya01004]
 Fatty acid synthase
  Animal type
   Dyak_GE28239
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE28239
  Exosomal proteins of breast milk
   Dyak_GE28239
  Exosomal proteins of colorectal cancer cells
   Dyak_GE28239
  Exosomal proteins of bladder cancer cells
   Dyak_GE28239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KR Acyl_transf_1 PS-DH Thioesterase ADH_zinc_N_2 ADH_zinc_N PP-binding Abhydrolase_1 Abhydrolase_6 FSH1
Motif
Other DBs
NCBI-GeneID: 26535420
NCBI-ProteinID: XP_015044769
FlyBase: FBpp0358561 FBgn0276394
UniProt: A0A0R1E8I8
LinkDB All DBs
Position
Unknown
AA seq 1772 aa AA seqDB search
MMLAAYYRGRVSVDLEKIRGSMAAVGLSFKTVLNMLPKSIETACHNGPDSCTISGPLEDV
SQFVADLKTKGIFAKEVPCSNIAYHSKYISHMGPPLLQYMNEIIPHPKPRTKKWLSTSVP
KIDWNKDQAKFCSAEYHTNNLLNSVLFEETFSLLPKNSLTIEVAPHGLLGAILKRSMPSG
VHIPLTNRGNQNNAAFFLSALGKIYLNGVLVPVANLYERIQFPVSRTTPSVSSLIRWDHS
EDWFVTKYENMKTKSSGERVFSVNLASDNEEFLSGHIIDGKILVPATCYLQYVWETFSLM
YHGPSYMDVPVEFEDIRFMRATSMPVNGKVELTVMIHYGTGHFEITELGSSVVTGIIRET
EKPSIPEVYNYQSNSKFPMIAKKDFYKELKLRGYHYNGAFQAVHLARSDGLFGQVQWNYN
WVTFMDAMLQIQILGTDSRNLLLPTKIRKLKINGVHHFDLMTKMDPENRVFDVYVDPMYD
RIIAGGIEIVGLHASLVQRRRPPGIPVLEEYVFLPFSSSSILSLRNAARVCVQIAIENNP
TLKLKLVEVGTDGINLMLTEFIEAIQDLPVITGEYTLLTSQNLEDIAGVHIENNSLSTQT
NCHIVLLGGYEEDELQNKITSAHSVLVDNGYIVLRQKSIKNVSCKISEHFRIITRIPIDK
TEENVVLLQKISKKLAVQPILVKVSQYDKAFDWISDLQTAITTKAPVVVYSFNEVLNGLI
GLVNCLRKEPDGNLIRCFFIDDDCAPDFDLSHPFYSTQYSLGLAFNIYRNGFWGSYRHLQ
LLKNDEPSERLDHIYGNVIQRGDLSSLQWIKGPLESKNCQIKIAFSSLNFRDVMLATGRL
AVELYGSSRIDQNCVLGFEYSGINMLTGRRIMSMVVKGGVASYVQEPSKLIWDIPDHWSL
QEAATVPVVYITVYYAFFMATDIRKGKSILIHAGTGGIGLAAIRVALAYNLEVFTTCSTA
QKKEFLLNTFPKLKGSHIGNSRDTSFELMVQRETNGKGVDFVLNSLSEEKLLASLRCLGK
SGHFLEIGKFDMASDNKIGLGCFLKEITFHAVLADSLLVAPEEDIWHLKALIDLDISKGI
IQPLPVKVFPAHEIEQAFRHLVGGKHIGKVVIQVREQPHDPSTLPVRVLSQVYFKPNLTY
VIPGGLGGFGMELSDWMALRGARKLLLSSSRGITKDYQLFRIALWKTYGCEVAVSTADIA
SKKGCAQLLSEATGMGPVGGIFNLAVALKDNIFPNQNVNQFLECFAPKAIATKNLDDLSR
IYCPELEHFVVFSSVSCGRGNAGQSNYGMANSVMERIIEHRNRDGFPGKAIQWGAVGEVG
LVADMAEDKIDMEIGGTLQQRISSCIQELDHLLSADASIVSSMVVAEKRTVRTGHESVID
AVMNIMGIRDLKSVSLGTTLSEMGMDSLMAVEIKQTLERDFELVLTPQDLRLLTFQKLQE
FIDAKEKENTDDKKIIFASDNKLLGMELLIRNLGDEANCDQVIIPLKTSAAPSKQNLQPN
IFIPGLEGTAGGAWYKLGSSLQSRASVLQLHQFAHLENLKDVAQQSFDQVKPILKQTEPF
YIIGYSFGTFIALQLAELLENSGFRGHIMLLDGAPHFLKRLTNLHLGEKFSDNDLYDLLF
SSIVNHIFPEESKESISAVFHQVDCLSEKMSLFMEYVEKQNIYSKKYSSTMVKAMFNRVK
MAASFDLDGIAKIKSPITLVRPAEASLQDIDEDYCISLLTSGAVTLKVIEGNHTTMLDNP
ALSQIIDDFDPVLLEDKHFEEYIRNDKPVSVV
NT seq 5319 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggccgcatattatcgaggaagagtaagcgtggacctcgaaaaaataagaggt
tcaatggcagcagtaggtctaagctttaaaactgttctaaatatgctgcctaagtccatc
gaaacggcttgccataatggcccggactcgtgcacaatatctggtccacttgaagatgtt
tcccaatttgtagctgatttaaaaacgaagggaatctttgcaaaggaagtgccttgctca
aatatagcttatcactcaaaatatatttcacacatggggccgccattacttcaatatatg
aatgaaattatcccacatcctaagcctagaactaaaaaatggttgagtactagtgtccct
aaaatcgactggaataaggatcaagcaaagttttgctctgcagaatatcatacgaataac
ctgttaaatagtgtactctttgaggaaacattttcgttgttacctaaaaattcattaact
atagaagtagcgcctcatggacttttaggagctattcttaaaaggtcaatgcctagtggt
gtacatattcctctcacaaacaggggtaaccaaaataatgcggcattttttttgtcggct
ctgggaaaaatatatttaaatggagttttagtacccgttgcaaacttatatgaaagaata
cagtttcctgtttcacgcacaacgcccagtgttagctcgcttattcgctgggatcatagt
gaggactggttcgtaacaaaatacgagaatatgaaaaccaagtccagcggagaacgtgtg
ttttcagttaatttagcgagtgacaacgaagagttcttaagtggacatataatagatgga
aaaatccttgttccagctacatgctatcttcaatatgtttgggaaacattttcacttatg
taccatggaccgagctatatggatgttcccgttgaattcgaggatatacgtttcatgaga
gctacaagtatgccagttaatggtaaagtggagttaaccgttatgattcactatggcact
ggccattttgagataacagaattgggcagttcagtggttaccggtattattcgtgagact
gaaaaaccatctattccagaggtttataattaccaaagtaattcgaagtttcccatgatt
gccaagaaagacttttacaaggagcttaaactccgtggttatcattacaatggcgcattt
caagccgttcatttggcccgttcagatggtttgtttggacaggtccaatggaattataat
tgggttaccttcatggacgcaatgcttcaaattcaaatattgggaactgattcacgaaat
ctcttattacccaccaaaattcggaaacttaagataaatggagtgcatcatttcgattta
atgaccaaaatggatccggaaaatcgagtttttgatgtttatgtggaccccatgtacgat
cggatcatagcgggtggaatagaaattgtcgggttacatgctagtctagtgcaaagacga
agacctcccggaattccagttcttgaggaatatgtatttctcccgttttcttcatcctct
attctttctttacgaaatgctgcccgtgtttgcgttcaaatcgctattgagaataatccc
accctaaaattgaaattggtagaggttggtactgatgggataaatctcatgctaactgaa
tttattgaagcaattcaagatttacccgtcattactggcgaatatacccttttaacatct
caaaatctagaagatattgctggagttcatattgaaaataatagtttgtctactcaaact
aattgtcatattgttttattgggaggctatgaagaagacgaattacaaaataaaattacg
tctgcacacagtgtactagtcgacaatggatatattgtgctccgacaaaaatctataaaa
aatgtgtcttgtaaaatatcggaacattttcgtataattacaagaattccgatagataaa
actgaagaaaatgttgtcctgttacagaaaatttcaaaaaaactcgcagtgcagcctatt
ttagtgaaagtatctcaatacgataaagcatttgactggatttcagacttgcagactgca
attacaacaaaagccccagtggttgtgtattcgtttaacgaagtattgaacggactgatt
ggtcttgtaaactgtttgcgaaaagaacctgatggtaatttgataagatgcttttttatt
gatgatgactgtgccccagattttgacctgtctcaccctttttattcgactcagtattca
ttgggtttggcgtttaacatttatcgcaatggtttttggggaagctataggcatttgcaa
ttactcaaaaatgatgagccatcggagagactagatcacatttacggaaacgtcattcaa
cgtggagatttgtcgagcttgcaatggataaaaggacctttagaatcaaaaaattgccag
attaaaatagctttctcttccttaaattttcgagatgtaatgctagcaactggtcggtta
gccgttgaattatatgggtcaagccgaatagatcaaaactgtgtattggggtttgaatac
tctggcatcaatatgttaactggacgtcgaataatgagcatggtcgttaaaggtggtgta
gcttcctatgtacaagaaccatcaaaacttatttgggatattcccgatcactggtcatta
caagaggcagctacagtgccagtggtgtatataactgtatactatgcattctttatggca
accgatatccgaaaaggaaaaagcattcttatacatgctggtactggaggcattggttta
gcagctatccgagtagcattggcttataacttggaagttttcacaacatgtagtactgct
caaaaaaaagaattcttattaaacacttttccgaaactaaaaggttcccatattggaaac
tctcgagatacatcattcgagcttatggtgcagcgtgagacgaatggaaaaggggtagac
tttgttttgaactcattatccgaagaaaagctgctggcttcattgcgttgtcttggaaag
tcaggacatttcttggaaattggaaaatttgatatggccagcgataacaagattggattg
ggttgctttttaaaagaaattactttccatgcggtactggctgatagtcttcttgtggct
cctgaggaagatatttggcacttaaaagcccttattgacttggacatttctaaaggaatc
attcaaccgttacccgttaaagtgttcccggctcatgaaattgaacaggccttcagacat
ttggttggtggcaaacacataggaaaagttgttattcaagttcgtgagcagccacacgat
ccatcaacattacctgtccgcgttcttagccaagtttattttaagcctaatcttacttat
gttattcctggtggcctaggaggttttggaatggaattgtctgattggatggctctacgt
ggagctcgaaagcttttgctgagctctagccgtggcattacaaaagattatcagttattt
agaattgcgctttggaaaacttatggctgcgaagtcgctgtaagtaccgcagatattgca
tcaaaaaagggatgcgctcaactactttctgaggctactggtatgggcccagtgggagga
atttttaatctcgcagttgcgttaaaagataacatttttccaaaccaaaatgtaaaccaa
tttttagaatgctttgcaccaaaagctatcgcaaccaaaaacctggacgacctatcccga
atttattgtccagagctggaacatttcgtagttttttccagcgtgtcttgtggccgggga
aatgccggccaatcaaattatggaatggctaattcagttatggaacgtataattgagcat
cgcaatagagacggctttccaggtaaagctattcaatggggtgcagtcggtgaagtgggc
ttagtggcagatatggcagaagacaaaatagacatggaaataggaggtactctacaacaa
cgaatttcatcgtgtatccaggaactggaccacttacttagcgctgatgcatcaattgtt
tcaagcatggtggtcgctgaaaaacgcactgtgcggactgggcatgaaagcgttattgac
gccgtcatgaatataatgggaatacgagacttaaaatcagtttctttaggtacaacactt
tcagaaatgggtatggactctttaatggctgttgagattaagcaaactttagaacgcgac
ttcgagttagttttgactccacaagatttacgactgctgacttttcaaaaactccaagag
tttattgacgctaaagaaaaagagaatacagatgacaagaaaattatatttgcttccgac
aataagcttttgggaatggagctattaattcgaaacttaggcgatgaagcgaactgtgac
caagtaataatcccgctcaagacatctgcagctccctcaaaacagaaccttcaaccaaac
atttttatacctggattagagggtacagctggaggtgcatggtacaaattaggatcaagt
ctgcaaagccgggctagtgttttacagctccatcagtttgcacatttggaaaatcttaaa
gatgtggcacagcaaagctttgatcaagttaaacccattttaaagcaaacagaacccttt
tatataattggatactcgtttggaacgtttatagctttacagcttgctgagttgctcgaa
aattctgggttccgtggacatattatgttattagatggagcaccacattttttgaaacga
cttactaatttacacttgggcgaaaaattttcggataacgacctttatgatctactgttt
tctagtattgttaatcatatatttccagaagaatctaaggagtctatatccgcagtcttt
caccaagtggactgcctctcagaaaaaatgtcgctgttcatggaatatgttgaaaaacaa
aatatatacagcaagaaatactcttcgacaatggtaaaagccatgttcaacagagtaaaa
atggctgcttcctttgatttagatggtatagccaaaattaaatctccaattactttagtt
cggccggctgaggcttcactgcaagatattgatgaagactattgcatttcgttactgaca
tctggggctgtaacactgaaagtaattgaaggaaatcatacaactatgttagataatcca
gcgctaagtcagataattgatgattttgatccagtacttctggaagataaacattttgaa
gaatatataagaaatgacaaaccggtttcagttgtataa

DBGET integrated database retrieval system