KEGG   Dyella sp. M7H15-1: EO087_07885Help
Entry
EO087_07885       CDS       T05846                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00020  Citrate cycle (TCA cycle)
dye00190  Oxidative phosphorylation
dye00650  Butanoate metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
Module
dye_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dye_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dye_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EO087_07885
   00650 Butanoate metabolism
    EO087_07885
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EO087_07885
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EO087_07885
    1.3.5.4  fumarate reductase (quinol)
     EO087_07885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: QAU23919
UniProt: A0A410UI01
LinkDB All DBs
Position
complement(1681293..1682075)
Genome map
AA seq 260 aa AA seqDB search
MAEFTLPKNSKIQPGKHYPAKDAKKPRTFRIYRWSPDDGQNPRIDIYEVDLAACGPMVLD
ALLKIKNEIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKAIDECPSGDVKIYPLPHMP
VVKDLVPDLTHFYAQFASIKPWLRTQSAAPDRERLQSPEDRKKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAILLQAYRWIVDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCPKG
LNPAKAIAEIKKLIVERRSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagttcacgctacccaagaattccaagatccagccgggcaagcactatccggcg
aaagacgcgaagaaaccgcgtacgttccgcatttaccgctggtcgccggacgacggccag
aacccgcgcatcgacatctatgaagtcgacctggccgcctgcggcccgatggttttggac
gcgctgttgaagatcaagaacgagatcgaccccacgctcaccctgcgccgctcgtgccgt
gaaggcatctgtggctcgtgcgcgatgaacatcgacggcaccaacacgctggcctgcacc
aaggccatcgatgagtgcccgtcaggcgatgtgaagatctatccgctgccgcatatgccg
gtggtgaaagatctcgtgccggatctcacccacttctacgcccagttcgcgtcgatcaag
ccgtggctgcgcacgcagagtgcggcgccggaccgcgaacgtctgcagtcgccggaagac
cgcaagaagctcgatggcctgtatgagtgcatcctgtgcgcgtgctgctcaaccagttgc
ccgagctactggtggaacggtgatcgttatctcggcccggcgatcctgctgcaagcctat
cgctggattgtcgactcgcgtgacgaagacaccggtgcacgtctggatgatctggaagat
ccgttcaagctgtaccgatgtcacactatcatgaattgcgcccgcacctgcccgaagggt
ttgaatccagcgaaggcgattgcggagatcaagaagttgattgtggagcgtcgttcggcg
taa

DBGET integrated database retrieval system