KEGG   Dyella sp. M7H15-1: EO087_07890Help
Entry
EO087_07890       CDS       T05846                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00020  Citrate cycle (TCA cycle)
dye00190  Oxidative phosphorylation
dye00650  Butanoate metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01130  Biosynthesis of antibiotics
dye01200  Carbon metabolism
Module
dye_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dye_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dye_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EO087_07890
   00650 Butanoate metabolism
    EO087_07890
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EO087_07890
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EO087_07890
    1.3.5.4  fumarate reductase (quinol)
     EO087_07890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: QAU23920
UniProt: A0A410UI16
LinkDB All DBs
Position
complement(1682364..1684151)
Genome map
AA seq 595 aa AA seqDB search
MEAYKIQQHKYDVIVVGAGGAGLRATFGLAEKGLKAACITKVFPTRSHTVAAQGGIAAAL
GNMGEDDWRFHFYDTIKGSDWLGDQDAIEYMCREAIPSILELEHYGVPFSRTDDGRIYQR
PFGGMTTHYGKGTAQRTCAAADRTGHAILHTLYQQALAHDATFFIEYFAIDLIFDDDGVC
RGVLALDMNEGTLHLFRGQAVVLATGGYGRTYFSATSAHTCTGDGGGMVLRSGLALQDME
FVQFHPTGIYGAGCLITEGVRGEGGYLTNSKGERFMERYAPSAKDLASRDVVSRAMTVEI
REGRGVGEHKDHVHLNLMHLGPEVIHERLPGIAESARIFAGVDVTKEPIPVLPTVHYNMG
GIPTNYHGEVVQKKGDDVDSVVPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAVSHR
CAEIIKPGLAHKDLPASALDKALGRFDALRHANGGTPTAKIRQDMQRTMQEDAAVFRTGE
TLKAGSKKISDVYDSFKDVHVSDRSMVWNSDLIETLELSNLLGQAVATMHSAEQRPESRG
AHAREDFPDRDDHNWMKHTLVKVDENGKTSFDFRPVHMYTLTPEVEVVPPKKRVY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacaagattcagcagcacaaatatgacgtgatcgtggtcggcgccggtggc
gcgggtctgcgcgccaccttcggcctggccgaaaagggcctcaaggccgcgtgtatcacc
aaggtgttcccgacccgctcgcataccgtggcggcgcagggtggcattgccgccgcgctc
ggcaacatgggcgaggacgattggcgtttccacttctacgacaccatcaagggttcggac
tggttgggtgaccaggacgccatcgaatatatgtgccgcgaggccattccttcgatcctc
gaactggaacactacggcgtgccgttctcgcgtaccgatgacggccgcatctaccagcgc
ccgttcggcggcatgaccacgcattacggcaagggcaccgcgcagcgtacctgcgccgcc
gccgaccgtaccggccacgcgatcctgcacacgctgtaccagcaggcgctggcgcatgac
gctactttctttatcgaatacttcgccatcgatttgatcttcgatgatgatggcgtgtgc
cgtggcgtacttgcgctcgacatgaacgagggcacgctgcatctgtttcgcggtcaggcg
gtggtgctggcgacgggcggttacggccgtacgtacttcagcgcaacctccgcacacacc
tgtacgggtgacggtggtggcatggtgctacgttccggtcttgccttgcaggacatggag
ttcgtgcagttccatcccactggcatttatggcgcgggttgcctgatcaccgaaggtgtg
cgcggcgaaggtggttatctcaccaattccaagggcgaacgtttcatggagcgctatgcg
ccgagcgctaaggatctcgcatcgcgcgatgtggtcagccgcgccatgacggttgagatt
cgcgaaggccgcggcgtgggcgaacacaaggatcatgtacatctgaacctgatgcatttg
ggtccagaagtgattcacgagcgtctgccaggtattgccgaatcggcacgcatctttgcc
ggcgtggacgtcaccaaggaaccgatcccggtactgccgaccgtgcactacaacatgggc
ggcattcccaccaactatcacggcgaagtcgtgcagaagaagggcgacgacgtggattcg
gtcgtacccggtctgttcgccattggcgaagcggcttgcgtgtccgtgcatggcgccaat
cgccttggttccaattcgctgctcgacctggtggtgttcggtcgcgcggtgtcgcatcgc
tgcgctgaaatcatcaagccgggtctggcgcataaggatctgccggccagcgcgttggac
aaggcgcttggccgtttcgacgccttgcgtcacgcgaatggcggcacgccaacggcgaag
atccgccaggacatgcagcgcaccatgcaggaagatgcggccgtgttccgtaccggcgaa
acgctgaaggcgggttcgaagaagatctccgatgtttatgactccttcaaggacgtgcac
gtgagcgaccgttcgatggtgtggaactccgacctcatcgaaacgctggagctgtccaac
ctgctgggccaggccgtcgccactatgcattcggctgagcagcgcccggaaagtcgcggt
gcacatgctcgcgaggacttccccgatcgtgacgatcacaactggatgaaacacacgttg
gtgaaggtcgacgaaaacggcaagaccagcttcgacttccgcccggtgcacatgtacacc
ttgacccccgaggtcgaggtagtgccgccgaagaagcgcgtttattaa

DBGET integrated database retrieval system