KEGG   Dyella sp. M7H15-1: EO087_08925Help
Entry
EO087_08925       CDS       T05846                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00550  Peptidoglycan biosynthesis
dye01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EO087_08925
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EO087_08925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dye01011]
    EO087_08925
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dye03036]
    EO087_08925
Enzymes [BR:dye01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EO087_08925
Peptidoglycan biosynthesis and degradation proteins [BR:dye01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EO087_08925
Chromosome and associated proteins [BR:dye03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    EO087_08925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: QAU24101
UniProt: A0A410UIR2
LinkDB All DBs
Position
complement(1899480..1901300)
Genome map
AA seq 606 aa AA seqDB search
MNWLPRPSAKPAARRQGMGPSARRRMLLVVGILGAASLGLVARAFDLQVVRKQFYQNQGD
ARFLRVVPIAVSRGTIFDRNGEPLAVSTPMVSITVVPSEVLDNTDRIPTLAQALGTHPDD
LKNYLEQRADREFAYLRRQMSPDAAQAVLDLGVPGVNGQREYKRYYPSGEVTAHVLGFTN
IDDHGQEGLELAFDSWLAGKPGAKRVIRDRMGHIVEDVEQVRAPQPGQNLTLSIDRRIQF
LAYSELKKQLEDLSADSGEMVILDVHTGEILAMVSLPTYNPNAVTGSAPAQRRNRAVTDV
VEPGSTMKPFTMAAGLSSGKYTPTAPMIDTGNGHWYFMGKDIRDVESGGNGVLTPTGVLT
KSSNIGAAKIALSLDSKFLYDTYRAFGYGESTSSGFPGESAGFLKTSRGWRPIEKATMGY
GYGLNVTPLQLAVAYGTLADNGIRHTPTFIKGGADAGMQIISPVIARELVNMLETVTAPG
GSATRAQIANYIVAGKTGTAHLVLGGGYAKNNYNSLFAGIVPATDPRLVGVVVINNPKSS
IYYGGLVSAPVFQRVMTGALRLLDVPPDNIGRWYAGGPLQAGGGLAGTAPAQNTPDDRST
VEAVDP
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcttccacgtcccagcgccaaacccgccgcgcgccgccaaggcatggggccg
agtgcacgccgccgcatgctgttggtggtcggcatcctcggtgccgcatcgttgggtttg
gtcgcgcgagccttcgacctgcaggtggtgcgcaagcagttctatcagaaccagggtgat
gcgcgtttcctgcgcgtggtgccgattgcggtgtcgcgcggcaccatcttcgatcgcaac
ggcgagccgctggcggtgtccacgccgatggtgtcgatcacggtcgtgccgtcggaagtg
ctcgataacaccgatcgtatccccacactcgcgcaggcgctgggcactcatcccgatgat
ctgaagaactatctcgaacaacgcgccgatcgcgaattcgcctatctgcgccggcagatg
agcccggacgcggcgcaggccgtgctcgatctgggtgtgcccggcgtcaacggccagcgt
gaatacaagcgctattacccgtccggtgaagtgaccgcacacgtgctcggcttcaccaat
atcgacgatcacggccaggagggtctggagctggccttcgatagctggcttgcgggcaag
ccgggcgccaagcgtgtgattcgcgaccgtatgggccacattgtggaagatgtggagcag
gtgcgtgcgccgcagccggggcagaatctcacgctcagcatcgatcgccgcattcagttc
ctcgcctacagcgagctgaagaagcaactggaggatctcagcgctgattccggtgaaatg
gtgatcttggacgtacacaccggcgagatcctcgccatggtcagcttgcctacctacaat
cccaacgcggtcaccggtagtgcgcccgcgcagcgtcgcaatcgcgccgtgactgacgtg
gtcgagccgggctcgaccatgaagccgttcaccatggcggcaggtctgtccagtggcaaa
tacacgcccaccgcgccgatgatcgataccggcaacggacactggtatttcatgggcaag
gacatccgtgacgtcgaatcgggcggcaacggtgtgcttacgcccaccggcgtgttgacc
aagtccagcaatatcggtgcggcaaaaattgcactgtcgctggatagtaaattcctttac
gacacctatcgcgccttcggttacggcgagagcaccagcagcggtttcccaggtgaatcg
gcaggctttctcaagaccagtcgcggctggcgtccgatcgaaaaagccaccatgggctac
ggttacggcctcaacgttacgccgctgcaactggccgtggcctacggcacgctggcggat
aatggcatacggcatacgcctaccttcattaagggtggcgccgatgcgggcatgcagatc
atctcgccagttatcgcgcgcgagcttgtcaacatgttggaaacggtgacggcgccgggc
gggtcggccacgcgtgcgcagatcgccaactacatcgtcgccggcaagactggcacggcg
catctggtgttggggggcggctatgcgaagaacaactacaactcgctgttcgctggcatt
gtgccggccaccgatccgcgtctggtcggcgtggtggtgatcaacaatcccaagtccagc
atttactacggcggcctggtgtccgcgccggtgtttcagcgtgtgatgactggcgcgctg
cgtctgcttgatgtgccaccggataacattggtcgctggtatgccggcggtccgttgcag
gccggcggtgggttggccggtaccgctccagcgcaaaacacgccagatgaccgatccacc
gtggaggccgtcgacccatga

DBGET integrated database retrieval system