KEGG   Dyella sp. M7H15-1: EO087_11440Help
Entry
EO087_11440       CDS       T05846                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dye  Dyella sp. M7H15-1
Brite
KEGG Orthology (KO) [BR:dye00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EO087_11440 (ahpF)
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EO087_11440 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 Thi4 DAO K_oxygenase AlaDh_PNT_C NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QAU24522
UniProt: A0A410UK13
LinkDB All DBs
Position
complement(2468243..2469826)
Genome map
AA seq 527 aa AA seqDB search
MLDNDLKTQLKAYLEKVVHPIELVASLDDGAKSQELRALLQDIEALSDRISLSLNGNDAR
KPSFAINRSGTDVGVRFAGIPMGHEFTSLVLALLQVGGHPPKVSDEVIEQVRILEGEYVF
ETFMSLSCHSCPDTVQALNLMSVLNPNIKHVAIDGALFQDEVDRRQVMSVPTVFLNGEPF
DQGRMSIEQIAARLDSGAAQRAAEKIKTKAAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVPYTEGPKLATALEQHVHEYDVDVMNLQCAERLIPAAEEGG
LIEVKLANGASLKAKSVILSTGARWRNMNVPGEQEYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLLEFDSKLRADEVLQRKLRSLPNVNIIISAQTTEVSGDG
QKVTSLVYTDRTSNQDHRVELEGVFVQIGLLPNTEWLKGTVKLSSRGEIDVDARGETSVP
GVFAAGDVTIVPYKQIVIAMGEGAKASLSAFDYLIRLPVEEQEAVAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggataacgacctgaaaacccagctcaaggcttacctggagaaagtggttcatccg
atcgagctggtggcctccctcgacgatggcgccaagtcgcaagaactgcgcgcgctgctg
caggatatcgaagcgttgtccgatcgcatctcgctgagcctcaacggtaacgacgcgcgc
aagccgtcattcgcgatcaaccgcagcggcacggatgtcggcgtgcgctttgccggcatc
ccgatgggtcacgaattcacttcgctggtattggcgctgctgcaggttggcggtcatcca
cccaaggtgtcggacgaagtgatcgagcaggtgcgcatccttgaaggcgaatatgtgttc
gaaaccttcatgtcgttgtcctgtcatagctgtccggataccgtgcaggcgctgaatttg
atgagcgtgctcaatcccaacatcaagcacgtggcgattgatggcgcgctgtttcaggac
gaagtggaccgacgtcaggtgatgtccgtgccgaccgtgttcctcaacggcgagccgttc
gaccagggccgcatgtcgatcgaacagatcgctgcccgccttgatagcggtgccgcccag
cgcgctgccgagaagatcaagaccaaggccgcgttcgatgtgctggtgatcggcggtggt
ccggcgggcgccgcggcagccatctatgccgcacgcaagggcatccgcacgggcgtggcg
gcggagcgtttcggtggccaggtgctggacaccatggcgatcgaaaacttcatctcggtg
ccgtataccgaaggtccgaagctggcgacggcactggaacagcacgtgcacgaatacgat
gtggacgtgatgaacctgcagtgtgccgagcggttgattccagcagccgaagaaggcggg
ctgatcgaagtgaagttggccaacggcgcctcgctcaaggcgaaatcggtgatcctttcc
accggtgcgcgctggcgcaacatgaacgtgccgggcgagcaggaataccgcaacaagggt
gtcacctattgcccgcactgcgacggtccgctgttcaagggcaagcgtgtggcagtgatt
ggcggtggcaactccggggtggaagcggcgatcgaccttgccggtatcgtgggccacgtc
accttgctggaattcgacagcaaactgcgtgcggatgaggtgctccagcgcaagctgcgc
agcctgcccaacgtcaacatcatcatcagcgcgcaaaccaccgaagtgtcgggcgacggc
cagaaagtgaccagcctggtctacaccgatcgcaccagcaaccaagaccatcgcgtggag
ctggaaggcgtcttcgtgcagatcggcttgttgccgaacaccgaatggctgaagggcacg
gtaaaactgtcgtcgcgtggcgagatcgatgtggatgcgcgtggcgaaacgtcggtgccg
ggcgtattcgccgctggtgacgtcacgatcgtgccgtacaaacagatcgtgattgcgatg
ggcgaaggtgcgaaggcatcactgagtgcgttcgattacctgatccgtctgcccgtggaa
gagcaagaagccgtcgcagcctga

DBGET integrated database retrieval system