KEGG   Dysgonomonas sp. HDW5A: G7050_00675Help
Entry
G7050_00675       CDS       T06482                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dys  Dysgonomonas sp. HDW5A
Brite
KEGG Orthology (KO) [BR:dys00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G7050_00675 (ahpF)
Enzymes [BR:dys01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G7050_00675 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 FAD_oxidored NAD_binding_8 DAO AlaDh_PNT_C Thi4 NAD_binding_7 FAD_binding_3 Glutaredoxin 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QIK58429
LinkDB All DBs
Position
complement(192867..194423)
Genome map
AA seq 518 aa AA seqDB search
MLDSSLKEQLRTVFADLKAQYTFNIAVSDQHESRSELLEMLSDVASCSDKITSQVNEGNG
LEFSLLKDGAKTGVKFRGIPNGHEFTSLLLAILNSDGKGKNIPDDFIVGRVKALKGPVRL
TTYVSLTCTNCPDIVQALNLMAILNPDISHEMVDGALNQEEVDALKLQGVPAVFADGKLL
HVGRGDFGELLSKLENQYGSDDQKIETGTTKNYDVVVVGGGPAGAAAAIYSARKGLTVAL
LAERMGGQVKETVGIENLVSVPKTTGEELANNMKLHIKDYAIDVLEHRLVEKVENEDGSK
IIYTNVGEKLITPALIIATGASWRKLNVTGESEYIGKGVAFCPHCDGPFYKGKHAAVVGG
GNSGIEAAIDLAGICSKVTVFEFLDELKADKVLQEKARSLPNVKIILSSQTTEVVGNGDK
VTGIRVKDRKTEQERVVELDGIFVQIGLAANSSVFKGLVSMNRFGEIEVDAHCRTDIPGI
YAAGDVTTVPYKQIIIAMGEGAKASLSAFEDRIRGVLS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttagattcctctttaaaagaacagttacgtacagtatttgccgatcttaaggctcaa
tatacatttaatatagccgtgtctgatcagcatgaaagccgtagcgaattactcgaaatg
ctttcagatgttgcttcgtgctcggataaaataacaagtcaagtaaacgaaggtaatggt
ctggaattctcgctactgaaagatggggcgaaaacaggcgttaaatttcgtggaattccc
aatggtcatgaatttacctcattgctattagctatattgaatagtgatggtaaagggaaa
aatattcccgatgattttattgtcggtcgtgtaaaagcattaaaaggacctgttcgcctg
actacctatgtgtcgttgacatgtacaaactgtcctgatattgttcaggcactaaatcta
atggctatccttaatcctgacatctctcatgaaatggtagatggtgcattaaatcaggaa
gaagtagatgctttgaaattgcaaggtgttcctgctgtatttgcagatgggaaactgctt
catgtaggaagaggcgattttggcgaattgctttcgaagcttgaaaaccagtatggttca
gacgaccaaaagatagagaccggtactactaaaaactacgatgtagtagttgttggtgga
ggtcctgcaggtgcagccgcagctatatattcggctcgtaaaggtttgactgttgcgtta
cttgccgagcgtatgggtgggcaggtgaaagaaactgtcggtatagagaatctggtttct
gtaccaaaaactacaggcgaagaacttgccaataatatgaagttgcatataaaagattat
gcaattgatgtattagagcatcgcttggtagagaaggttgaaaacgaagatggtagtaag
attatatatactaatgtaggcgaaaaattaataactcctgccctgattattgctacaggg
gcaagttggcgtaagcttaatgttacaggagaatcggaatacataggaaaaggtgttgcc
ttctgtccccattgcgacgggcctttttataaaggaaaacatgcagccgttgtgggtggt
ggaaactcaggaatagaggctgctattgatttggcaggtatctgctctaaagtaaccgtt
ttcgaatttctggatgaattgaaggctgataaagttttacaagagaaagccagaagtctt
cctaatgtaaaaattatactaagttctcaaacaactgaggttgtagggaatggagataag
gttacaggtattcgagtaaaagaccgtaagactgaacaggaacgtgttgttgaactggat
ggtatctttgttcagatcggtttggctgccaacagttcggtattcaaaggattagtgagt
atgaatcgttttggcgaaattgaagtcgatgctcattgccgtacagatatacccggtata
tatgctgcgggtgatgtaacgactgttccgtacaagcaaattataatagcgatgggagaa
ggtgcaaaagcttcgctttcggcctttgaagatcgtatcagaggtgttctctcttaa

DBGET integrated database retrieval system