KEGG   Dickeya zeae EC1: W909_02645Help
Entry
W909_02645        CDS       T03567                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dzc  Dickeya zeae EC1
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    W909_02645
Enzymes [BR:dzc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     W909_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin NAD_binding_8 Thi4 DAO FAD_binding_3 K_oxygenase AlaDh_PNT_C FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: AJC65062
UniProt: A0A0A8F9D8
LinkDB All DBs
Position
564776..566338
Genome map
AA seq 520 aa AA seqDB search
MLDNNVQLQLKTYLEKLTKPVELVATLDDSAKSAEVRALLTDIAGLSDKVSFFENNDLPV
RKPSFLVTNPGAANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAKELLDQIRDLDGKFH
FETYYSLTCHNCPDVVQALNLMSILNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FSQGRMSLAEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPG
QPHQIETASGAVLKSRSIIIATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRTTDSVHKLALEGIFVQIGLLPNTNWLDGAIERNRIGEIEIDARCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataacgtgcaactccagttgaaaacctacctggaaaaattaaccaaacct
gttgagttagtggcgacactggacgactcagcgaaatctgctgaagtccgggcattgctg
actgacatcgccgggttgtccgacaaagtcagtttctttgaaaataacgatctgccggtg
cgtaaaccgtcgtttctggtgaccaacccaggggctgccaacgggccgcgctttgccggt
gcgccgatggggcacgaattcacctcgctggtgctggcgttactgcaaactggtggacat
ccgtcgaaagaagcgaaagaactcctcgatcaaatccgcgacctggacggtaaattccac
tttgaaacctattattcgctgacctgtcataactgcccggatgtggtacaggcgctgaat
ttaatgtccatcctgaatccgaacgtgacccataccgcgatcgacggcggtgtgtttcag
gatgagatcaaagatcgcaatatcatgggcgttcccacggtattcctgaacggcgaacac
ttcagccagggccgcatgagcctggcggaaatcgtcggcaaaattgacactggtgccaat
gcccgcgtggtcgataagctcaatagccgcccggtgtatgacgtgctgattgtcggcagt
ggcccggcaggggcagccgcagcggtgtatgcggcccgtaaaggcatccgcaccggtttg
atgggcgagcgtttcggcggccagattctggataccgtcgatattgaaaactacatttcg
gtaccgaaaaccgaaggtgccaaactggcgacagcgctgaaaacgcatgtggatgactac
gacgttgacgtcatcgatttgcagagcgcgcaaaaactgatccccgcttctgaaccgggt
cagccgcaccagatcgaaaccgcgtcgggtgcagtgctgaaatcccgtagcattatcatt
gctaccggtgcgcgctggcgcaacatgaacgtgccgggtgaagaacaataccgtacccgt
ggcgtcacctattgtccgcattgcgacggcccgctgttcaaaggcaagcatgtggcggtg
attggcggcggtaactccggcgtggaagcagcgattgatctggctggcgtggtgaagcat
gtgaccttgctggaattcgcaccggaactgaaagcagactccgtgttacaagacaagctg
cgtagcctgccgaacgtcgatgtgatcgtcaacgcacagaccaccgaagtgctaggtgac
ggccagaaagtcactggcttgcagtataaagatcgcaccaccgacagcgttcataagctg
gcgctggaagggattttcgtacaaatcggcctgctgccgaataccaactggctggacggt
gccattgaacgcaaccgcattggcgaaattgagatagacgctcgctgcgaaaccagcgtg
aaaggtgtgtttgccgccggtgactgcaccaccgtgccttacaagcagattattatcgcc
acgggcgaaggcgctaaagcctccctgagtgcgtttgattacttgatcagaacgcaggcg
taa

DBGET integrated database retrieval system