KEGG   Dickeya zeae EC1: W909_08355Help
Entry
W909_08355        CDS       T03567                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00550  Peptidoglycan biosynthesis
dzc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    W909_08355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dzc01002]
    W909_08355
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dzc01011]
    W909_08355
Enzymes [BR:dzc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     W909_08355
Peptidases and inhibitors [BR:dzc01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   W909_08355
Peptidoglycan biosynthesis and degradation proteins [BR:dzc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   W909_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJC66072
UniProt: A0A0A8FC97
LinkDB All DBs
Position
1837443..1838651
Genome map
AA seq 402 aa AA seqDB search
MKIVTPRISWRRIVAAATGMLMAVSPVLQAEQMTPPPQIDAKAFILIDYASGRVLAESNA
DTRLDPASLTKIMSSYVIGQAIKVGKITPDDKVTVGKDAWAGGNPTLRGSSLMFLKPGDQ
ISVSDLNKGIVIQSGNDASIALADYVAGSQNAFVSLMNQYAATLGLTNTHFLTVHGLDTP
GQYSTARDMARLTQALIRDVPSEYALHSEKEFTFNNIRQPNRNRLLWSSNLRVDGVKTGY
TDGAGHSLVASAVDSDMRLISVVLGAPSDSIRFRESEKLLTWGFRFFETATLIRSDTPFT
TQRVWLGSEKQVRLGVAQDAAMTVPKGQAKNLKASFTLAQRQLQAPLKKGQVVGTIDFQL
DGNSIGQRPLVVMDDIPQAGFFGRLWDTILMTLSGWFGGLFG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagtgacacctcgcatttcctggcgacgcatcgttgccgccgctaccgggatg
ttgatggcggtttcgccggtacttcaggccgagcagatgacgcctccaccgcaaattgac
gccaaagcgtttatcttgatcgattacgccagcggtcgggtgctggccgagtcaaatgca
gataccagactcgatcccgctagcctgaccaagatcatgtcgagctatgtgattgggcag
gccatcaaagtgggtaagatcacaccagacgataaagtgacggttggaaaagacgcctgg
gctggtggtaatccgacgttacgtgggtcgtcactgatgttcctcaagccgggtgatcag
atttcggtgtccgatcttaataaagggatagtgattcagtcgggtaatgatgccagtatc
gcactggcggattatgtcgccggaagccagaacgcgtttgtcagcctgatgaaccagtac
gccgcgacgctggggttgacgaatacccattttctgacggtacatggtctggatacgcca
gggcagtacagtacggcccgtgacatggcacgtctgacacaggcgttgattcgcgatgta
ccgagcgaatacgccttacatagtgagaaagagttcacattcaataatatccgccagcca
aaccgtaaccgtttgctgtggagcagtaacttgcgtgtggatggggtgaaaaccggctat
accgatggtgctggccacagtctggtggcctcggctgtcgatagtgacatgcggctgatt
tcggtggtactgggtgcgccttccgacagcatccgttttcgggaaagtgaaaaattgctg
acctgggggttccgtttctttgaaactgcgacgttgatacgcagcgacaccccctttacg
acccaacgggtatggcttggtagcgaaaagcaagtcagattaggggtagcgcaggatgcc
gcgatgacggtgccaaaagggcaggctaaaaatctgaaagccagctttacgttggcgcag
cggcagttgcaagccccgctgaaaaaagggcaggttgtcggcacgattgatttccaactc
gatggcaacagcatcggccaacgcccactggtggtgatggatgacataccgcaagcaggc
ttttttggccgcttatgggataccattttgatgacgttgtccggctggtttggcggatta
tttggctga

DBGET integrated database retrieval system